PL206843B1

July 17, 2018 | Author: Anonymous | Category: Каталог , Без категории
Share Embed


Short Description

Download PL206843B1 ...

Description

RZECZPOSPOLITA POLSKA

(12)

OPIS PATENTOWY

(19)

PL

206843 (13) B1 (11)

(21) Numer zgłoszenia: 362413 (22) Data zgłoszenia: 18.02.2002 (86) Data i numer zgłoszenia międzynarodowego: Urząd Patentowy Rzeczypospolitej Polskiej

(54)

18.02.2002, PCT/EP02/001687

(51) Int.Cl. A61K 39/395 (2006.01) C07K 7/08 (2006.01) C07K 16/28 (2006.01) A61P 35/00 (2006.01)

(87) Data i numer publikacji zgłoszenia międzynarodowego:

29.08.2002,WO02/066058

Zmodyfikowane przeciwciało anty-EGFR o obniżonej immunogeniczności lub jego fragment, kodująca je sekwencja DNA, zawierająca je kompozycja farmaceutyczna oraz sposób jego wytwarzania

(73) Uprawniony z patentu:

MERCK PATENT GMBH, Darmstadt, DE (30) Pierwszeństwo:

19.02.2001, EP, 01103954.2 (72) Twórca(y) wynalazku: (43) Zgłoszenie ogłoszono:

02.11.2004 BUP 22/04

FRANCIS J. CARR, Balmedie, GB GRAHAM CARTER, By Newmacher, GB TIM JONES, Babraham, GB STEPHEN WILLIAMS, Insch, GB ANITA HAMILTON, Aberdeen, GB

(45) O udzieleniu patentu ogłoszono:

30.09.2010 WUP 09/10 (74) Pełnomocnik:

PL 206843 B1

rzecz. pat. Szymon Łukaszyk

2

PL 206 843 B1

Opis wynalazku Przedmiotem wynalazku jest zmodyfikowane przeciwciało anty-EGFR o obniżonej immunogeniczności lub jego fragment, kodująca je sekwencja dna, zawierająca je kompozycja farmaceutyczna oraz sposób jego wytwarzania. Wynalazek dotyczy przeciwciał, które są skierowane na receptor EGF (HER1) do podawania zwłaszcza ludziom, a w szczególności do zastosowań terapeutycznych w guzach nowotworowych. Przeciwciała te są zmodyfikowane, przy czym modyfikacja prowadzi do obniżenia skłonności przeciwciała do wywoływania odpowiedzi immunologicznej po wprowadzeniu do ludzkiego organizmu. W szczególności wynalazek dotyczy modyfikacji przeciwciała 425 anty-EGFR oraz jego różnych form i fragmentów dla uzyskania odmian Mab 425, które są zasadniczo nieimmunogenne lub mniej immunogenne niż jakikolwiek niezmodyfikowany odpowiednik podczas stosowania in vivo. Wynalazek dotyczy ponadto białkowych epitopów limfocytów T pochodzących z rzeczonego niezmodyfikowanego przeciwciała, za pomocą których możliwe jest wytworzenie odmian zmodyfikowanego Mab 425 o obniżonej immunogeniczności. STAN TECHNIKI Receptor nabłonkowego czynnika wzrostu (receptor EGF lub EGFR), znany również pod nazwą c-erbB1/Her 1, oraz produkt ekspresji onkogenu neu (znany również pod nazwą c-erbB2/Her 2) są członkami nadrodziny receptorów nabłonkowego czynnika wzrostu (EFG) należącego do rozległej rodziny receptorów kinaz tyrozynowych. Reagują one na powierzchni komórki ze specyficznymi czynnikami wzrostu lub naturalnymi ligandami, takimi jak EGF czy TGF alfa, aktywując tym samym receptor kinazy tyrozynowej. Aktywowana jest kaskada białek sygnałowych, co prowadzi do wzmocnienia ekspresji genów i szybszego tempa wzrostu. C-erb B2 (Her 2) jest transmembranową kinazą tyrozynową o masie cząsteczkowej około 185'000, z zauważalną homologią do receptora EGF (Her 1), chociaż specyficzny ligand dla Her 2 nie został jeszcze jednoznacznie zidentyfikowany. Receptor EGF jest transmembranową glikoproteiną o masie cząsteczkowej około 170'000, występującą w licznych komórkach nabłonkowych. Jest on aktywowany przez przynajmniej trzy Ugandy: EGF, TGF-α (transformujący czynnik wzrostowy alfa) i amfiregulinę. Wykazano, że zarówno nabłonkowy czynnik wzrostowy (EGF) jak i transformujący czynnik wzrostowy alfa (TGF-α) wykazują właściwości wiązania się z receptorem EGF i prowadzą do proliferacji komórek i powiększenia nowotworu. Wymienione czynniki wzrostu nie wiążą się z Her 2 (Urich und Schlesinger, 1990, Cell 61, 203). W odróżnieniu od kilku rodzin czynników wzrostu, które powodują dimeryzację receptora dzięki swojej dimerycznej naturze (na przykład PDGF), monomeryczne czynniki wzrostu, takie jak EGF, zawierają dwa miejsca wiązania dla swoich receptorów i dlatego są w stanie związać dwa sąsiadujące ze sobą receptory EGF (Lemmon et al., 1997, EMBO J. 16. 281). Dimeryzacja receptora jest konieczna do stymulowania potencjalnej katalitycznej aktywności i do autofosforylacji receptorów czynnika wzrostu. Należy zauważyć, że receptory kinaz białkowo-tyrozynowych (ang. protein tyrosine kinases - PTKs) są zdolne zarówno do homo-, jak i heterodimeryzacji. Badania kliniczne dowodzą, iż zarówno receptor EGF, jak i c-erb B2 ulegają nadmiernej ekspresji w niektórych typach nowotworów, szczególnie w nowotworach piersi, jajników, pęcherza moczowego, okrężnicy, nerek, mózgu, szyi i łuskowatym nowotworze płuc. (Mendelsohn, 1989, Cancer Cells 7, 359; Mendelsohn, 1990, Cancer Biology 1, 339). Obserwacje te zapoczątkowały badania przedkliniczne, których obiektem było hamowanie funkcji ludzkich receptorów EGF lub c-erb B2 jako nowoczesnych terapeutycznych procedur leczenia chorób nowotworowych (patrz, np. Baselga et al., 1996, J. Clin. Oncol. 14, 737; Fan i Mendelsohn, 1998, Curr. Opin. Oncol. 10, 67). Odnotowano, że na przykład przeciwciała przeciwko receptorowi EFG, podobnie jak przeciwciała anty-Her 2 uzyskują bardzo dobre wyniki w leczeniu ludzkich chorób nowotworowych. Dlatego też humanizowane przeciwciało monoklonalne 4D5 (hMAb 4D5, HERCEPTYNA®) jest już dostępne w sprzedaży. Wykazano, że blokując wiązanie EGF i TGF-α z receptorem, przeciwciała przeciwko receptorowi EGF wywołują inhibicję proliferacji komórek nowotworowych. W następstwie tych odkryć uzyskano mysie i szczurze przeciwciała monoklonalne przeciwko receptorowi EGF i testowano ich możliwości inhibicji rozwoju komórek nowotworowych in vitro i in vivo ( Modjtahedi i Dean, 1994, J Oncology 4, 277). Humanizowane przeciwciało monoklonalne 425 (hMAb 425) (opisy patentowe US 5,558,864; EP 0531 472) i chimeryczne przeciwciało monoklonalne 225 (cMAb 225) (Naramura et al., 1993, Cancer Immunol. Immunother. 37, 343-349; opis patentowy WO 96/40210), oba skierowane przeciw receptorowi EGF, okazały się skuteczne w próbach klinicznych.

PL 206 843 B1

3

Wykazano, że przeciwciało C225 hamuje in vitro przyrost komórek nowotworowych, w którym pośredniczy EGF i zapobiega powstaniu ludzkiego nowotworu in vivo u bezsierściowych myszy. Ponadto odnotowano również synergistyczne działanie przeciwciała z głównymi grupami chemioterapeutyków (np. doksorubicyną, adriamycyną, taksolem, i cisplatyną) w eradykacji ludzkich nowotworów in vivo w ksenoprzeszczepach z zastosowaniem mysich modeli. Ye et al. (1999, Oncogene 18, 731) stwierdzili, że ludzkie komórki raka jajnika mogą być skutecznie leczone kombinacją zarówno cMAb 225, jak i hMab 4D5. Istnieje wiele przypadków, w których efektywność białka terapeutycznego jest ograniczona poprzez nieoczekiwaną odpowiedź immunologiczną na to białko terapeutyczne. Niektóre mysie przeciwciała monoklonalne okazały się obiecujące w terapiach w wielu ludzkich zespołach chorobowych, ale w pewnych przypadkach zawiodły z powodu znacznej indukcji odpowiedzi ludzkiego przeciwciała skierowanego przeciwko mysiemu (ang. Human Anti Murine Antibody - HAMA) [Schroff, R. W. et al, (1985) Cancer Res. 45: 879-885; Shawler, D.L. et al, (1985) J.Immunol. 135: 1530-1535]. Szereg technik zostało opracowanych w celu redukcji odpowiedzi HAMA na monoklonalne przeciwciała [opisy patentowe WO 89/09622; EP 0239400; EP 0438310; WO 91/06667]. Podejścia z zastosowaniem rekombinowanego DNA ograniczyły ogólnie mysią informację genetyczną w końcowej strukturze przeciwciała, zwiększając jednocześnie ludzką informację genetyczną w ostatecznej konstrukcji. Mimo wszystko, końcowe „humanizowane" przeciwciała wywoływały w kilku przypadkach odpowiedź immunologiczną u pacjentów [Issacs J.D. (1990) Sem.Immunol. 2: 449, 456; Rebelio, P.R. et al, (1999) Transplantation 68: 1417-1420]. Przeciwciała nie są jedyną klasą cząsteczek polipeptydowych podawanych jako czynnik terapeutyczny, na które odpowiedź innmunologiczna może być podwyższona. Nawet białka ludzkiego pochodzenia, z taką samą sekwencją aminokwasową jaka występuje u człowieka, mogą nadal wywoływać odpowiedź immunologiczną u ludzi. Warte przytoczenia przykłady dotyczą między innymi terapeutycznego zastosowania czynnika stymulującego wzrost koloni granulocytów i makrofagów [Wadhwa, M. et al, (1999) Clin.Cancer.Res. 5: 1353-1361] i interferonu alfa 2 [Russo, D. et al, (1996) Bri.J.Haem. 94: 300-305; Stein, R. et al, (1988) New Engl.J.Med. 318: 1409-1413]. Głównym czynnikiem indukującym odpowiedź immunologiczną jest obecność w strukturze białka peptydów, które mogą stymulować aktywność limfocytów T poprzez prezentowanie na cząsteczkach MHC klasy II, tzw. „epitopów limfocytów T". Takie potencjalne epitopy limfocytów T są powszechnie definiowane jako dowolna sekwencja reszt aminokwasowych, mająca zdolność wiązania się z cząsteczkami MHC klasy II. Epitopy limfocytów T mogą być analizowane dla określenia wiązania z MHC. Niezaprzeczalnie, „epitop limfocytu T" oznacza epitop, który kiedy jest związany z cząsteczką MHC, może być rozpoznany przez receptor limfocytu T (ang T-cell receptor TCR), i który może, przynajmniej ogólnie, wywołać aktywację tych limfocytów T, poprzez stymulację TCR do zapoczątkowania odpowiedzi limfocytów T. Jest to w większości przypadków zrozumiałe, że większość peptydów, w przypadku których odkryto, że wiążą się z cząsteczkami MHC klasy II, może być wkomponowane w sekwencje białka, ponieważ takie peptydy są rozpoznawane w organizmie, któremu podano końcowe białko. Wiadomo, że niektóre z tych peptydów będących epitopami limfocytów T, mogą być uwolnione podczas rozpadu peptydów, polipeptydów lub białek w komórkach i następnie prezentowane przez cząsteczki głównego układu zgodności tkankowej (ang. major histocompatability complex MHC) w celu zapoczątkowania aktywacji limfocytów T. W przypadku peptydów prezentowanych przez MHC klasy II, taka aktywacja limfocytów T może zatem prowadzić, na przykład do wzrostu odpowiedzi przeciwciała poprzez bezpośrednią stymulację limfocytów B do wytwarzania przeciwciał. Cząsteczki MHC klasy II są grupą wysoce polimorficznych białek, które odgrywają zasadniczą rolę w selekcji i aktywacji pomocniczych limfocytów T. Cząsteczki głównego układu zgodności tkankowej człowieka z grupy DR (ang. human leukocyte antigen group - HLA-DR) są dominującym izotypem tej grupy białek i głównym przedmiotem wynalazku. Jednakże, izotypy HLA-DQ i HLA-DP odgrywają podobne funkcje, stąd wynalazek znajduje wobec nich analogiczne zastosowanie. Cząsteczki DR MHC klasy II składają się z łańcucha alfa i łańcucha beta, który swoim C-terminalnym końcem przechodzi przez błonę komórkową. Każdy heterodimer posiada domenę wiążącą ligand, która wiąże się z peptydami różniącymi się długością od 9 do 20 aminokwasów, choć bruzda wiążąca może pomieścić maksymalnie 11 aminokwasów. Domena wiążąca ligand obejmuje odcinek łańcucha alfa od 1 do 85 aminokwasów oraz aminokwasy od 1 do 94 łańcucha beta. Okazało się, że cząsteczki DQ mają strukturę homologiczną i oczekuję się, że rodzina DP białek będzie bardzo podobna. U ludzi

4

PL 206 843 B1

znanych jest w przybliżeniu 70 różnych allotypów izotypu DR, dla DQ istnieje 30 różnych allotypów, a dla DP znanych jest 47 różnych allotypów. Każda jednostka posiada od dwóch do czterech alleli DR, dwa DQ i dwa allele DP. Struktura wielu cząsteczek DR została rozwiązana i struktury takie wykazują wolny koniec peptydowy bruzdy wiążącej z wieloma hydrofobowymi resztami (reszty kieszonki) peptydu [Brown et al. Nature (1993) 364: 33; Stern et al, (1994) Nature 368: 215]. Polimorfizm określający różne allotypy cząsteczek klasy II przyczynia się do szerokiej różnorodności różnych powierzchni wiązania dla peptydów w obrębie bruzdy wiążącej peptyd i na poziomie populacji zapewnia maksymalną elastyczność pod względem zdolności rozpoznawania obcych białek i wzmagania odpowiedzi immunologicznej na patogenne organizmy. Istnieje znaczący poziom polimorfizmu w obrębie domeny wiążącej peptyd, z wyraźnymi „rodzinami" w obrębie różnych populacji geograficznych i grup etnicznych. Polimorfizm ten wpływa na charakterystyki wiązania domeny wiążącej peptyd, przez co różne „rodziny" cząsteczek DR będą wykazywały specyficzność względem peptydów różniących się właściwościami sekwencji, choć może występować powtarzanie się tej cechy. Specyficzność ta ogranicza rozpoznawanie epitopów limfocytów Th (odpowiedz limfocytów klasy II), które ostatecznie są odpowiedzialne za przebieg odpowiedzi przeciwciała na epitopy komórek β obecne na tym samym białku, z którego wywodzi się epitop limfocytu Th. Zatem, odpowiedź immunologiczna jednostki na białko jest znacząco zależna od rozpoznania epitopu limfocytów T, które jest funkcją specyficzności wiązania peptydu dla indywidualnego allotypu HLA-DR tej jednostki. Dlatego, aby określić epitopy limfocytu T w obrębie białka lub peptydu dla całej populacji, jest pożądane aby rozpatrzyć właściwości wiązania tak zróżnicowanej grupy allotypów HLA-DR jak to możliwe, tym samym obejmując tak duży odsetek populacji jak to tylko jest możliwe. Odpowiedź immunologiczna na białko terapeutyczne, takie jak białko, które jest przedmiotem wynalazku, przebiega poprzez szlak prezentacji peptydu przez MHC klasy II. Egzogenne białka zostają otoczone i poddane prezentacji w połączeniu z cząsteczkami MHC klasy II typów DR, DO lub DP. Cząsteczki MHC klasy II są prezentowane przez wyspecjalizowane komórki prezentujące antygen APC (ang. antigen presenting cell), takie jak między innymi makrofagi i komórki dendryczne. Włączenie kompleksu białkowego MHC klasy II poprzez spokrewniony receptor limfocytu T na powierzchni limfocytu T, jednocześnie z połączeniem większości pozostałych co-receptorów takich jak cząsteczki CD4, może wywołać stan aktywacji łącznie z limfocytem T. Aktywacja prowadzi do uwolnienia cytokin dalej aktywujących inne limfocyty takie jak limfocyty B do produkcji przeciwciał lub aktywujące limfocyty KT (ang. killer T cells), co stanowi pełną immunologiczną odpowiedź komórkową. Zdolność peptydu do wiązania danej cząsteczki MHC klasy II w celu prezentacji na powierzchni APC zależy od wielu czynników, najbardziej znacząco od jego sekwencji pierwszo rzędowej. Będzie to miało wpływ zarówno na jego skłonność do rozszczepienia, a także na jego powinowactwo do wiązania w bruździe wiążącej peptyd cząsteczki MHC klasy II. Kompleks MHC klasy ll/peptyd na powierzchni APC prezentuje stronę wiążącą receptorowi właściwego limfocytu T (TCR) zdolnego do rozpoznania determinant dostarczanych zarówno przez prezentowane reszty peptydu jak i cząsteczkę MHC klasy II. Znane są procedury pozwalające na identyfikację syntetycznych peptydów zdolnych wiązać cząsteczki MHC klasy II (na przykład opisy patentowe WO 98/52976 i WO 00/34317). Peptydy takie mogą nie funkcjonować jako epitopy limfocytów T w każdym przypadku, głównie, in vivo w zależności od szlaku przekształcenia lub innych czynników. Określenie epitopów limfocytów T jest pierwszym krokiem w eliminacji epitopu. Określenie i usunięcie potencjalnych epitopów limfocytów T z białek zostało uprzednio ujawnione. Znane są praktyczne sposoby wykrywania epitopów limfocytów T za pomocą metod obliczeniowych, wyszukujących określone motywy sekwencyjne w eksperymentalnie określonych epitopach limfocytu T lub, alternatywnie, zastosowanie technik obliczeniowych dla przewidywania peptydów wiążących MHC klasy II, a zwłaszcza peptydów wiążących DR. Opisy patentowe WO 98/52976 i WO 00/34317 wskazują na wykorzystanie systemów wielowątkowych do identyfikacji sekwencji polipeptydowych z potencjałem wiązania podzbioru allotypów DR ludzkich MHC klasy II. Wskazano tam, że przewidywane epitopy limfocytów T są usuwane poprzez zastosowanie równorzędnej substytucji aminokwasu w obrębie pierwszorzędowej sekwencji terapeutycznego przeciwciała lub białka, które nie jest przeciwciałem pochodzenia zarówno ludzkiego jak i pozaludzkiego. Inne techniki wykorzystują rozpuszczalne kompleksy rekombinowanych cząsteczek MHC w połączeniu z syntetycznymi peptydami i zdolnymi do wiązania klonów limfocytów T z próbek krwi obwodowej ludzkiej lub zwierzęcia doświadczalnego. [Kern, F. et al, (1998) Nature Medicine 4:975-978; Kwok, W.W. et al, (2001) TRENDS in Immunology 22: 583-588] i mogą także być wykorzystane w strategii identyfikacji epitopu.

PL 206 843 B1

5

Jak zobrazowano powyżej i w konsekwencji, pożądana byłaby identyfikacja i usunięcie lub przynajmniej redukcja epitopów limfocytu T z danego zasadniczo wartościowego terapeutycznie ale normalnie immunogennego peptydu, polipeptydu lub immunoglobuliny. Zmodyfikowany Mab 425 został opisany wcześniej (opisy patentowe US 5,558,864; EP 0531 472) jak również chimeryczne i humanizowane odmiany c225 (opis patentowy WO96/40210) ale te podejścia były ukierunkowane na redukcję immunogenności poprzez sporządzenie chimerycznych i humanizowanych odmian rzeczonych przeciwciał z mysich form metodami standardowymi. Podejścia takie nie uwzględniają znaczenia epitopów limfocytów T na właściwości immunogenne białka ani nie uwzględniają bezpośredniego wpływu rzeczonych właściwości w specyficzny i kontrolowany sposób według zarysu wynalazku. Jednakże, istnieje ciągłe zapotrzebowanie na przeciwciała anty-EGFR o udoskonalonych właściwościach. Pożądane udoskonalenia obejmują alternatywne schematy i modele otrzymywania i oczyszczania rzeczonego terapeutyka, ale także i w szczególności, udoskonalenia biologicznych właściwości tej immunoglobuliny. Istnieje szczególna potrzeba udoskonalenia właściwości in vivo w przypadku podawania człowiekowi. Pod tym względem, jest wysoce pożądane otrzymanie przeciwciał anty-EGFR, w szczególności MAb 425 z ograniczonym potencjałem lub brakiem potencjału wywoływania odpowiedzi immunologicznej u człowieka. ISTOTA WYNALAZKU Istotą wynalazku są zmodyfikowane formy przeciwciał anty-EGFR, korzystnie MAb 425, w których właściwości immunologiczne zmieniono poprzez zredukowanie liczby lub usunięcie potencjalnych epitopów limfocytu T. Wynalazek obejmuje sekwencje zidentyfikowane w pierwszorzędowej sekwencji MAb 425, które są potencjalnymi epitopami limfocytu T ze względu na potencjał wiązania z MHC klasy II. Wynalazek obejmuje także specyficzne pozycje w obrębie pierwszorzędowej sekwencji cząsteczki, które według wynalazku mają być zmienione poprzez substytucję, addycję lub delecję określonego aminokwasu bez znaczącego wpływu na aktywność biologiczną. W przypadkach, w których utrata immunogeniczności może być osiągnięta jedynie przy jednoczesnej utracie aktywności biologicznej, lub specyfiki/zachłanności przeciwciała istnieje możliwość przywrócenia rzeczonej aktywności poprzez kolejne zmiany w obrębie sekwencji aminokwasowej odmiany przeciwciała. Istotą wynalazku jest ponadto sekwencja DNA kodująca ciężki i/lub lekki łańcuch tak zmodyfikowanego przeciwciała oraz kompozycja farmaceutyczna zawierająca tak zmodyfikowane przeciwciało. Istotą wynalazku są w końcu sposoby wytwarzania tak zmodyfikowanych przeciwciał, a przede wszystkim sposoby identyfikacji rzeczonych epitopów limfocytu T, które wymagają zmian w celu redukcji lub wyeliminowania jednostek immunogennych. Można się spodziewać, że przeciwciało anty-EGFR według wynalazku będzie wykazywać zwiększony czas krążenia w organizmie ludzkim i mogłoby być szczególnie korzystne w chronicznych i nawrotowych zespołach chorobowych takich samych jak w przypadku wielu wskazań. Wynalazek dostarcza zmodyfikowanych form białek rzeczonego przeciwciała, które jak się oczekuje będą wykazywać ulepszone właściwości in vivo. Takie zmodyfikowane cząsteczki przeciwciała anty-EGFR mogą być zastosowane w kompozycjach farmaceutycznych. Podsumowując istotą wynalazku są następujące zagadnienia: + zmodyfikowane przeciwciało lub jego fragment wybrany z grupy obejmującej fragmenty Fab, Fab', F(ab')2, Fv i Fc, dimery przeciwciał, liniowe przeciwciała, cząsteczki przeciwciał jednołańcuchowych i wielospecyficzne przeciwciała ukształtowane z fragmentu(fragmentów) przeciwciała, skierowany na receptor EGF (Her 1) pochodzący od mysiego przeciwciała 425 i zawierający, w porównaniu do oryginalnego immunogenicznie niezmodyfikowanego przeciwciała, zredukowaną liczbę sekwencji epitopów limfocytu T, które są ligandami MHC klasy II lub sekwencjami peptydowymi wykazującymi zdolność do stymulowania lub wiązania komórek T poprzez prezentację na cząsteczce klasy II, i będące zasadniczo nieimmunogenne lub mniej immunogenne niż jakiekolwiek oryginalne immunogenicznie niezmodyfikowane przeciwciało skierowane na ten sam receptor podczas narażenia na system immunologiczny danego gatunku, które charakteryzuje się tym, że rzeczone zmodyfikowane przeciwciało zawiera sekwencje VH i VK wybrane z grupy obejmującej: sekwencję VH1: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRTNY NEKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS

6

PL 206 843 B1

sekwencję VK1: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH2: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK2: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH3: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKOAPGQGLEWIGEFNPSNGRTNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK3: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGOGTKVEIK sekwencję VH4: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS sekwencję VK4: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK sekwencję VH5: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS sekwencję VK5: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK; - wskazane powyżej przeciwciało lub jego fragment, w którym rzeczone oryginalne immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem chimerycznym; - wskazane powyżej przeciwciało lub jego fragment, w którym rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem nie pochodzącym od człowieka, zawierającym reszty powierzchniowe za wyjątkiem tych nie będących w pobliżu regionów ODR, które pochodzą z odpowiednich ludzkich referencyjnych sekwencji szkieletowych (ang. veneered antibody - przeciwciało "oklejone"); - wskazane powyżej przeciwciało lub jego fragment, w którym rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem mysim mAb 425; - sekwencja DNA, kodująca ciężki i/lub lekki łańcuch wskazanego powyżej przeciwciała lub jego fragmentu; - kompozycja farmaceutyczna zawierająca wskazane powyżej przeciwciało lub jego fragment, opcjonalnie wraz z farmaceutycznie tolerowanym nośnikiem, rozpuszczalnikiem lub rozcieńczalnikiem; - wskazana powyżej kompozycja farmaceutyczna zawierająca dodatkowo lek cytotoksyczny w farmakologicznie skutecznej dawce. - sposób wytwarzania zmodyfikowanego przeciwciała skierowanego na receptor EGF (Her 1) i pochodzącego od mysiego przeciwciała mAb 425 i zawierającego, w porównaniu do oryginalnego immunogenicznie niezmodyfikowanego przeciwciała, zredukowaną liczbę sekwencji epitopów limfocytu T, które są ligandami MHC klasy II lub sekwencjami peptydowymi wykazującymi zdolność do stymulowania lub wiązania komórek T poprzez prezentację na klasie II, i będące zasadniczo nieimmunogenne lub mniej immunogenne niż jakiekolwiek oryginalne immunogenicznie niezmodyfikowane przeciwciało skierowane na ten sam receptor podczas narażenia na system immunologiczny danego gatunku, charakteryzujący się tym, że obejmuje następujące etapy: (i) określenie sekwencji aminokwasowej ciężkiego i/lub lekkiego łańcucha oryginalnego immunogenicznie niezmodyfikowanego przeciwciała lub jego fragmentu; (ii) identyfikacja jednego lub większej liczby potencjalnych epitopów limfocytu T w obrębie sekwencji aminokwasowej przeciwciała dowolną metodą włączając w to określenie wiązania peptydów do cząsteczki MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych, przy czym rzeczona identyfikacja obejmuje następujące etapy:

PL 206 843 B1

7

(a) wybór regionu peptydu mającego znaną sekwencję reszt aminokwasowych; (b) sekwencyjne pobieranie do analizy nakładających się segmentów reszt aminokwasowych o założonym jednakowym rozmiarze i złożonych z przynajmniej trzech reszt aminokwasowych z wybranego regionu; (c) wyliczenie punktacji wiązania MHC klasy II dla każdego pobranego do analizy segmentu poprzez zsumowanie wyznaczonych wartości dla każdego hydrofobowego bocznego łańcucha reszt aminokwasowych, obecnego w rzeczonym pobranym do analizy segmencie reszt aminokwasowych, przy czym etap ten jest przeprowadzany z zastosowaniem funkcji punktacyjnej (ang. scoring function) Böhma zmodyfikowanej dla uwzględnienia wyrazu energii odpychania 12-6 van der Waalsa ligandbiałko i wyrazu energii konformacji ligandu poprzez (1) dostarczenie pierwszej bazy danych modeli cząsteczki MHC klasy II; (2) dostarczenie drugiej bazy danych dopuszczalnych łańcuchów głównych peptydu dla rzeczonych modeli cząsteczki MHC klasy II; (3) wybór modelu z pierwszej rzeczonej bazy danych; (4) wybór dopuszczalnego łańcucha głównego z rzeczonej drugiej bazy danych; (5) określenie reszty aminokwasowej bocznych łańcuchów obecnej w każdym pobranym do analizy segmencie; (6) określenie wartości powinowactwa wiązania dla wszystkich bocznych łańcuchów obecnych w każdym wziętym do analizy łańcuchu; i powtórzenie etapów (1) do (5) dla każdego rzeczonego modelu oraz dla każdego rzeczonego łańcucha głównego; i (d) identyfikacja przynajmniej jednego z rzeczonych segmentów odpowiedniego do modyfikacji, w oparciu o wyliczoną dla tego segmentu punktacje wiązania cząsteczki MHC klasy II, dla zmiany całkowitej punktacji wiązania MHC klasy II dla peptydu bez zasadniczej redukcji terapeutycznego zastosowania tego peptydu; (iii) projektowanie wariantów nowej sekwencji z jednym lub większą liczbą aminokwasów w obrębie określonych potencjalnych epitopów limfocytu T zmodyfikowanych w taki sposób, aby zasadniczo zredukować lub wyeliminować aktywność epitopu limfocytu T jak określono przez wiązanie peptydów do cząsteczek MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych, lub poprzez wiązanie kompleksów białko-MHC z limfocytami T, przy czym modyfikacja epitopu limfocytu T jest przeprowadzana przez substytucję 1-9 reszt aminokwasowych w dowolnym z oryginalnie obecnych epitopów limfocytu T, (iv) konstruowanie takich wariantów sekwencji technikami rekombinacji DNA i testowanie rzeczonych wariantów dla określenia jednego lub większej liczby wariantów o pożądanych właściwościach; i (v) opcjonalnie powtarzanie etapów (ii), (iii) i (iv); - wskazany powyżej sposób, w którym rzeczone oryginalne immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem chimerycznym; - wskazany powyżej sposób, w którym rzeczone immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem nie pochodzącym od człowieka, zawierającym reszty powierzchniowe za wyjątkiem tych nie będących w pobliżu regionów CDR, które pochodzą od odpowiednich ludzkich referencyjnych sekwencji szkieletowych (ang. veneered antibody - przeciwciało "oklejone"); - wskazany powyżej sposób, w którym rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem mysim mAb 425; - wskazany powyżej sposób, w którym rzeczone immunogenicznie niezmodyfikowane przeciwciało skierowane na receptor EGFR zawiera sekwencje VH i VK wybrane z grupy obejmującej sekwencje wskazane powyżej dla zmodyfikowanego przeciwciała według wynalazku. Ogólny sposób według wynalazku prowadzący do zmodyfikowanych przeciwciał anty-EGFR obejmuje następujące etapy: (i) określenie sekwencji aminokwasowej przeciwciała lub jego części; (ii) identyfikacja jednego lub więcej potencjalnych epitopów limfocytu T w obrębie sekwencji aminokwasowej immunoglobuliny dowolną metodą określającą wiązanie peptydów z cząsteczkami MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych; (iii) zaprojektowanie nowych wariantów sekwencji z jednym lub więcej aminokwasami, w obrębie których zidentyfikowane potencjalne epitopy limfocytu T zmodyfikowane są w taki sposób, aby częściowo zredukować lub wyeliminować aktywność epitopu limfocytu T, określoną poprzez wiązanie peptydu do cząsteczki MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych.

8

PL 206 843 B1

Takie warianty sekwencji są tworzone w taki sposób, aby uniknąć powstawania nowych potencjalnych epitopów limfocytu T poprzez wariancje sekwencji, jeśli nie ma takich nowych potencjalnych epitopów limfocytu T, w kolejności, zmodyfikowane w taki sposób aby częściowo zredukować lub wyeliminować aktywność epitopu limfocytu T; i (iv) utworzenie takich wariantów sekwencji technikami rekombinacji DNA i testowanie rzeczonych wariantów w celu zidentyfikowania jednego lub więcej wariantów z pożądanymi właściwościami dobrze znanymi technikami rekombinacji. Identyfikacja potencjalnych epitopów limfocytu T według etapu (ii) może być również przeprowadzona według metod opisanych stanem techniki. Odpowiednie metody są zawarte w opisach patentowych WO 98/59244; WO 98/52976; WO 00/34317 i mogą korzystnie być zastosowane do określenia skłonności do wiązania peptydów pochodzących z MAb 425 z cząsteczką MHC klasy II. Niemniej jednak wyjątkowo wydajną metodą obliczeniową identyfikacji epitopów limfocytu T jest metoda opisana w przedstawionym poniżej przykładzie, który jest korzystną realizacją wynalazku. W praktyce wiele różnych immunoglobulin odmian anty-EGFR, korzystnie MAb 425, będzie wytworzonych i testowanych pod kątem pożądanej immunologicznej I funkcjonalnej charakterystyki. Te odmiany przeciwciał najbardziej korzystnie wytwarzane będą technikami rekombinacji DNA, chociaż inne procedury włączając w to chemiczną syntezę fragmentów przeciwciała mogą być równoważne. Wynalazek dotyczy także analogów przeciwciała, w których podstawienie przynajmniej jednej reszty aminokwasu zostało przeprowadzone w pozycjach, skutkujących istotną redukcją aktywności lub eliminacją z białka jednego lub większej liczby potencjalnych epitopów limfocytów T. Jedna lub większa liczba substytucji aminokwasów w konkretnych punktach, w obrębie dowolnego potencjalnego ligandu MHC klasy II określonego w tabeli 1, może prowadzić do MAb 425 o obniżonym potencjale immunogeniczności podczas podawania jako terapeutyka do ludzkiego organizmu gospodarza. Korzystne podstawienia aminokwasów są przeprowadzane we właściwych punktach w obrębie sekwencji peptydu, w przewidzianej do osiągnięcia istotnej redukcji lub eliminacji aktywności epitopu limfocytu T. W praktyce właściwy punkt będzie korzystnie odpowiadał reszcie aminokwasu związanego w jednej z kieszonek występującej w obrębie wiążącej bruzdy MHC klasy II. Szczególnie korzystna jest zmiana wiązania wewnątrz pierwszej kieszonki w pierwszej bruździe w tak zwanej P1 lub P2 pozycji zakotwiczenia peptydu (ang. anchor position). Jakość oddziaływań wiążących z pomiędzy resztą P1 kotwiczącą peptyd a pierwszą kieszonką wiążącej bruzdy MHC klasy II jest rozpoznawana jako główna determinanta całkowitego powinowactwa wiązania do całego peptydu. Właściwa substytucja w takiej pozycji peptydu będzie dotyczyła reszty trudniej ulokowanej w kieszonce, na przykład substytucji na resztę bardziej hydrofilową. Reszty aminokwasu w peptydzie w pozycji odpowiadającej wiązaniu w innych obszarach kieszonki w obrębie bruzdy wiążącej MHC są także brane pod uwagę i wchodzą w zakres wynalazku. Należy rozumieć, że substytucja pojedynczego aminokwasu w obrębie danego potencjalnego epitopu limfocytu T jest główną korzystną drogą, na której epitop może być wyeliminowany. Kombinacja substytucji w obrębie pojedynczego epitopu może być rozważona i dla przykładu może być znacząco właściwa kiedy konkretnie określone epitopy nakładają się na siebie. Ponadto, substytucje aminokwasu, albo pojedyncze w obrębie danego epitopu, albo w kombinacji w obrębie pojedynczego epitopu, mogą być przeprowadzone w pozycjach nie odpowiadających „resztom kieszonki" ze względu na wiążącą bruzdę MHC klasy II, ale w dowolnym punkcie w sekwencji peptydu. Substytucje mogą być przeprowadzone w odniesieniu do homologicznych struktur lub metodą strukturalną, z zastosowaniem technik in silico znanych ze stanu techniki i mogą być oparte na znanych cechach struktury cząsteczki według wynalazku. Wszystkie takie substytucje wchodzą w zakres wynalazku. Substytucje aminokwasu inne niż w obrębie peptydów określonych powyżej mogą być brane pod uwagę szczególnie kiedy przeprowadzane są w kombinacji z substytucją(substytucjami) przeprowadzaną w obrębie wymienionego peptydu. Na przykład zmiana może prowadzić do przywrócenia struktury lub biologicznej aktywności wariantu cząsteczki. Takie zmiany kompensujące i zmiany z włączeniem delecji lub addycji konkretnych reszt aminokwasu z przeciwciała anty-EGFR skutkują wariantem o pożądanej aktywności i w kombinacji ze zmianami w dowolnym z przedstawionych peptydów wchodzą w zakres wynalazku. Chociaż istotą wynalazku jest zmodyfikowane przeciwciała anty-EGFR, korzystnie MAb 425, w zakresie wynalazku znajdują się kompozycje zawierające takie zmodyfikowane immunoglobuliny lub ich fragmenty w połączeniu z ich białkami i odpowiednie ich kompozycje. W innym aspekcie istotą wynalazku jest kwas nukleinowy kodujący zmodyfikowane przeciwciała anty-EGFR, korzystnie

PL 206 843 B1

9

MAb 425. W dalszym aspekcie wynalazek dotyczy także sposobów postępowania terapeutycznego u ludzi z zastosowaniem zmodyfikowanych immunoglobulin. SZCZEGÓŁOWY OPIS WYNALAZKU Należy zaznaczyć, że termin "mniejsza lub obniżona immunogeniczność" używany dotychczas i później jest terminem względnym i odnosi się do immunogeniczności pierwotnego przeciwciała źródłowego podczas narażenia in vivo na ten sam rodzaj w porównaniu do przeciwciała modyfikowanego według wynalazku. Zatem wyjściowe przeciwciała mogą być całkowicie pochodzenia poza ludzkiego, tak jak przeciwciała mysie lub szczurze. Jednakże, istotą wynalazku są przeciwciała które już zawierają ludzkie sekwencje, takie jak chimeryczne lub humanizowane przeciwciała. W tych sztucznie zaprojektowanych przeciwciałach otrzymanych klasycznymi standardowymi metodami istnieją sekwencję w obrębie struktury pierwszorzędowej, które nadal są immunogenne. Jest także możliwe, że podczas produkcji takich chimerycznych lub humanizowanych odmian powszechnie znanymi sposobami wygenerowane są nowe epitopy limfocytu T. Nawet całkowicie ludzkie przeciwciała lub ich fragmenty mogą być immunogenne dla pewnych jednostek ludzkich lub grup jednostek mających genetycznie immunogennie inny model. Termin "przeciwciało chimeryczne" oznacza przeciwciała, w których fragment ciężkiego i/lub lekkiego łańcucha jest identyczny albo homologiczny do odpowiednich sekwencji w przeciwciałach otrzymanych od poszczególnych gatunków lub należący do przeciwciał szczególnej klasy lub podklasy przeciwciał, podczas gdy reszta łańcucha(łańcuchów) jest identyczna lub homologiczna do odpowiednich sekwencji przeciwciał pochodzących od innego gatunku lub należących do innej klasy lub podklasy przeciwciał, podobnie jak fragmenty takich przeciwciał, jeżeli tylko wykazują one pożądaną aktywność biologiczną (na przykład: US 4,816,567; Morrison et al. Proc.Nat.Acad.Sci. USA, 81:6851-6855 (1984)). Metody sporządzania chimerycznych i ludzkich przeciwciał są także znane. Na przykład metody sporządzania chimerycznych przeciwciał obejmujących te opisane patentach Boss (Celltech) i Gabilly (Genentech) (US 4,816,397; US 4,816,567). Termin "Humanizowane przeciwciała" oznacza odmiany nie pochodzących od człowieka (np. gryzonia) przeciwciał chimerycznych, które zawierają minimalną sekwencję nie pochodzącej od człowieka immunoglobuliny. W większości przypadków humanizowane przeciwciała są ludzkimi immunoglobulinami (przeciwciało będące biorcą), w którym reszty z hyperzmiennego regionu (CDRs) biorcy zostały zastąpione resztami z hyperzmiennego regionu pochodzącego z innego gatunku niż ludzkiego (przeciwciało będące donorem) takich jak mysz, szczur, królik lub z naczelnych (z wykluczeniem człowieka) mającego pożądaną specyficzność, powinowactwo i wydajność. W niektórych przypadkach, reszty regionu szkieletowego (FR) (ang. framework region) ludzkiej immunoglobuliny zastąpione są odpowiednimi resztami nie pochodzącymi od człowieka. Ogólnie, zasadniczo wszystkie humanizowane przeciwciała będą zawierały przynajmniej jedną, a typowo dwie, zmienne domeny, w których wszystkie lub zasadniczo wszystkie z hyperzmiennych pętli odpowiadające tym z nie-ludzkiej immunoglobuliny i wszystkie lub zasadniczo wszystkie z FR są tymi z ludzkiej sekwencji immunoglobuliny. Humanizowane przeciwciało opcjonalnie także będzie zawierać przynajmniej fragment regionu stałego (Fc) immunoglobuliny, typowo z ludzkiej immunoglobuliny. Sposoby sporządzania humanizowanych przeciwciał są na przykład opisane przez Winter (US 5,225,539) i Boss (Celltech, US 4,816,397). "Fragmenty przeciwciała" zawierają fragment nienaruszonego przeciwciała, korzystnie zawierający miejsce wiązania antygenu z jego zmiennego regionu. Przykładami fragmentów przeciwciała są fragmenty Fab, Fab', F(ab')2, Fv i Fc, dimery przeciwciał, liniowe przeciwciała, cząsteczki przeciwciała jednołańcuchowe; i wielospecyficzne przeciwciała ukształtowane z fragmentu(fragmentów) przeciwciała. "Nienaruszone" przeciwciało jest tym, które zawiera wiążący antygen region zmienny jak również stałą domenę (ang. constant domainCL) łańcucha lekkiego i stałe domeny łańcucha ciężkiego, CH1, CH2 i CH3. Korzystnie, nienaruszone przeciwciało ma jedną lub więcej funkcji efektorowych. W wyniku trawienia przeciwciał papainą powstają dwa identyczne fragmenty wiążące antygen, zwane fragmentami "Fab", każdy zawierający pojedyncze miejsce wiążące antygen i region CL i CH1 oraz fragment reszty "Fc", których nazwy odzwierciedlają ich zdolność do łatwego ulegania krystalizacji. Region "Fc" przeciwciała zawiera z reguły, CH2, CH3 oraz region zawiasowy z IgG1 lub lgG2 głównych klas przeciwciał. Trawienie pepsyną daje fragment "F(ab')2", który ma dwa miejsca wiążące antygen i dalej jest zdolny do związania antygenu. "Fv" jest najmniejszym fragmentem przeciwciała, który zawiera całkowicie takie miejsce rozpoznające antygen i miejsce wiążące antygen. Region ten składa się z dimeru jednego łańcucha ciężkiego i jednego łańcucha lekkiego domeny zmiennej w ścisłym nie-kowalencyjnym połączeniu. Fragmenty przeciwciał określane jako "pojedynczy łańcuch FV" lub "scFv" zawierają VH i VL domen przeciwciała, w którym te domeny występują w pojedynczym łańcuchu peptydowym. Korzystnie ten Fv

10

PL 206 843 B1

polipeptyd dodatkowo zawiera łącznik polipeptydowy między domenami VH i VL co umożliwia scFv tworzenie pożądanej struktury dla wiązania antygenu. Jednołańcuchowe przeciwciała FV są znane, dla przykładu z Plückthun (The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg i Moor red., Springer-Verlag, New York, str. 269-315 (1994)), opisy patentowe WO 93/16185; US 5,571,894; US 5,587,458; Huston et al. (1988, Proc. Natl. Acad. Sci. 85, 5879) lub Skerra i Plueckthun (1988, Science 240, 1038). Termin „epitop limfocytu T" oznacza według wynalazku, sekwencję aminokwasową, która jest zdolna do wiązania MHC klasy II, zdolna stymulować limfocyty T i/lub także zdolna do wiązania (bez konieczności mierzalnej aktywacji) limfocytów T w kompleks z MHC klasy II. Termin „peptyd" jak zastosowano w opisie i w załączonych zastrzeżeniach oznacza związek, który zawiera dwa lub większą liczbę aminokwasów. Aminokwasy są złączone razem poprzez wiązanie peptydowe (zdefiniowane poniżej). Istnieje 20 różnych naturalnie występujących aminokwasów uczestniczących w biologicznej produkcji peptydów, i każda ich liczba może być połączona w dowolnej kolejności dla utworzenia łańcucha peptydowego lub pierścienia. Wszystkie naturalnie występujące aminokwasy biorące udział w biologicznej syntezie peptydów mają konfigurację L. Syntetyczne peptydy mogą być otrzymywane z wykorzystaniem konwencjonalnych metod syntezy, wykorzystując L-aminokwasy, D-aminokwasy, lub różne kombinacje aminokwasów o dwóch różnych konfiguracjach. Niektóre peptydy zawierają tylko kilka jednostek aminokwasów. Krótkie peptydy, na przykład mające mniej niż 10 jednostek aminokwasów, są często określane jako „oligopeptydy". Inne peptydy zawierają dużą liczbę reszt aminokwasowych, na przykład 100 lub więcej, i są określane jako „polipeptydy". Umownie, termin „polipeptyd" może być rozpatrywany jako dowolny łańcuch peptydowy zawierający trzy lub większą liczbę aminokwasów, podczas gdy „oligopeptyd" jest przeważnie rozpatrywany jako szczególny rodzaj „krótkiego" polipeptydu. Zatem, jak tu zastosowano należy rozumieć, że każde odniesienie do „polipeptydu" obejmuje także oligopeptyd. Ponadto, każde odniesienie do „peptydu" obejmuje polipeptydy, oligopeptydy, i białka. Każde odmienne ułożenie aminokwasów daje różne polipeptydy lub białka. Liczba polipeptydów, a stąd liczba różnych białek, które mogą zostać utworzone jest praktycznie nieograniczona. Termin „zmodyfikowane białko/przeciwciało" według wynalazku oznacza białko/przeciwciało posiadające ograniczoną liczbę epitopów limfocytów T i ujawniające tym samym zredukowaną immunogeniczność w porównaniu do rodzimych białek podczas narażenia na system immunologiczny danego gatunku. Termin „niezmodyfikowane białko/przeciwciało" według wynalazku oznacza białko „ojca" w porównaniu do „białka zmodyfikowanego" i posiada większą liczbę epitopów limfocytów limfocytów a tym samym, zwiększoną immunogeniczność w porównaniu do rodzimych białek podczas narażenia na system immunologiczny danego gatunku. Termin „węgiel alfa (Cα)" oznacza atom węgla komponentu węgiel-wodór (ang. carbon-hydrogen - CH) znajdującego się w łańcuchu peptydowym. „Łańcuch boczny" jest poboczną grupą Cα, która może zawierać prostą lub złożoną grupę lub cząsteczkę, mającą fizyczne wymiary różniące się znacząco w porównaniu z wymiarami peptydu. W kolejnych akapitach wynalazek został opisany bardziej szczegółowo dla monoklonalnego przeciwciała 425 anty-EGFR, które wykazuje wysoką wartość terapeutyczną. Jednakże, wynalazek nie ogranicza się do tego przeciwciała i kilku jego występujących form, ale może być rozszerzony na inne przeciwciała anty-EGFR, przede wszystkim chimeryczne przeciwciało 225, które ma bardzo podobne właściwości. Jeśli nie określono inaczej, wszystkie aminokwasy w zmiennych ciężkim i lekkim łańcuchu są numerowane za Kabat et al. 1991 (Sequences of Proteins of Immunological Interest, US Department of Health and Human Services). Potencjalne epitopy limfocytu T są numerowane jak pierwszy aminokwas epitopu, licząc od pierwszego aminokwasu ciężkiego i lekkiego łańcucha. 1. Porównanie z sekwencjami szkieletowymi podgrupy mysiej. Sekwencje aminokwasowe mysiego 425 VH (łańcuch ciężki) i VK (łańcuch lekki) zostały porównane do analogicznych sekwencji dla podgrup Kabat mysich łańcucha ciężkiego i lekkiego. 425 VH może być przypisany do mysich ciężkich łańcuchów podgrupy NB. Porównanie z analogiczną sekwencją dla tej podgrupy wskazuje, że seryna w pozycji 94 w 425 VH jest nietypowa. Najczęstszą resztą w tej pozycji jest arginina. 425 VK może być przypisany do mysich kappa łańcuchów podgrupy VI. Porównanie z analogiczną sekwencją dla tej podgrupy wskazuje, że reszty w pozycjach 45-47, 60 i 100 w 425 VK są nietypowe dla tej podgrupy. Numeracja reszt aminokwasowych jest za Kabat. 2. Porównanie z sekwencjami szkieletowymi występującymi u ludzi. Sekwencje aminokwasów mysiego 425 VH (zmienny łańcuch ciężki) i VK (zmienny kappa lekki łańcuch) zostały porównane z sekwencjami z katalogu VH ludzkiej linii zarodkowej (Tomlinson, I.M.

PL 206 843 B1

11

et al., (1992) J.Mol.Biol. 227: 776-798) oraz z sekwencjami VK (Cox, J.P.L. et al. (1994) Eur. J. Immunol. 24: 827-836) a także z sekwencjami regionu J ludzkiej linii zarodkowej (Routledge, E.G. etal., w Protein Engineering of Antibody Molecules for Prophylactic and Therapeutic Applications in Man, Clark M. red. Academic Titles, Nottingham, UK, str. 13-44, 1991). Sekwencje mysiego 425 dla ciężkiego i lekkiego łańcucha mogą zostać zaczerpnięte na przykład z opisu patentowego EP 0531 472. Referencyjną sekwencją szkieletową występującą u ludzi dla 425 VH był sVH1GRR z ludzkim JH6. W katalogu sekwencja VH1GRR kończy się na reszcie 88. Dlatego nie istnieje analogiczna reszta dla nietypowej seryny w pozycji 94 w sekwencji mysiej. Ta sekwencja linii zarodkowej została znaleziona w zmodyfikowanym genie kodującym dojrzałe przeciwciało z 4 zmienionymi aminokwasami. Referencyjną sekwencją szkieletową występującą u ludzi wybraną dla 425 VK była L6/vg z ludzkim JK2. Sekwencja linii zarodkowej została znaleziona w zmodyfikowanym łańcuchu ciężkim dojrzałego przeciwciała bez żadnych zmian aminokwasów. 3. Projektowanie "oklejonych" sekwencji. Po określeniu referencyjnych sekwencji szkieletowych występujących u ludzi, zostały zmienione pewne nieidentyczne reszty aminokwasów w obrębie sekwencji szkieletowej 425 VH i VK na odpowiadające aminokwasy w ludzkiej referencyjnej sekwencji szkieletowej. Reszty, które są uważane za krytyczne dla struktury przeciwciała oraz wiązania zostały wykluczone z tego procesu i były nie zmieniane. Sekwencje mysie, które pozostawiono na tym etapie są w większości nie-powierzchniowymi, schowanymi resztami, dla przykładu daleko od reszt na końcu N, które są w pobliżu CDR w końcowym przeciwciele. (1-8, korzystnie 1-5 reszt aminokwasów). Proces ten wytwarza sekwencję, która jest w dużym stopniu podobna do "oklejonego" przeciwciała gdzie powierzchniowe reszty są głównie ludzkie a reszty schowane są takie jak w normalnej mysiej sekwencji. 4. Liniowa analiza peptydu. Mysie i "oklejone" 425 VH i VK były analizowane z zastosowaniem sposobu według wynalazku. Sekwencje aminokwasów zostają podzielone na wszystkie możliwe fragmenty składające się z 13 jednostek. Takie 13-jednostkowe peptydy są kolejno podstawiane do modeli wiążącego rowka allotypów HLA-DR i parametr wiązania jest przypisany dla każdego peptydu i dla każdego allelu. Parametr konformacyjny jest wyliczony dla każdego wiążącego się z kieszonką łańcucha bocznego peptydu. Parametr ten jest oparty na sferycznym nakładaniu się, potencjalnych wiązaniach wodorowych między peptydami i resztami w wiążącym rowku, oddziaływaniach elektrostatycznych i korzystnymi oddziaływaniami pomiędzy peptydem i resztami kieszonki. Konformacja każdego łańcucha jest potem zmieniana i parametr wyliczany ponownie. Mając określone najwyższe parametry konformacyjne, oblicza się parametr wiązania w oparciu o związane z rowkiem reszty hydrofobowe, reszty hydrofilowe nie związane z rowkiem i liczbą reszt, które pasują do wiążącego rowka. Peptydy, które jak wiadomo, wiążą się z ludzkim MHC klasy II osiągają znaczący parametr wiązania, prawie nigdy o wartości ujemnej. Zatem peptydy, które osiągają znaczący parametr wiązania w tej analizie są rozpatrywane jako potencjalne epitopy limfocytu T. Wyniki liniowej analizy peptydu są przedstawione w tabeli 1 dla 425 VH i 425 VK. Potencjalne epitopy limfocytu T są określone poprzez numerację pierwszej reszty z fragmentu 13-jednostkowego. T a b e l a 1: Potencjalne epitopy limfocytu T w mysich i "oklejonych" sekwencjach 425. Liczba potencjalnych epitopów limfocytu T

Numer pierwszej reszty w cząsteczce składającej się z 13 podjednostek oraz liczba wiążących alleli w nawiasach

Mysie 425 VH

8

31(7), 35(17), 43(7), 46(8), 58(10), 62(12), 81(11), 84(16)

"Oklejone" 425 VH

7

31(7), 43(7), 46(8), 58(10), 62(11), 81(11), 84(16)

Mysie 425 VK

9

1(8), 2(5), 17(5), 27(5), 43(16), 72(18), 75(10), 92(10), 93(17)

"Oklejone" 425 VK

4

27(5), 43(16), 92(8), 93(17)

Sekwencja

5. Usuwanie Potencjalnych Epitopów Limfocytu T. Numeracja reszt aminokwasów do substytucji przeprowadzono za Kabat. Potencjalne epitopy limfocytu T są określone poprzez numerację pierwszej reszty z 13-jednostkowego fragmentu. Substytucje aminokwasów konieczne do usunięcia potencjalnych epitopów limfocytu T z "oklejonego" 425 ciężkiego łańcucha zmiennego regionu są następujące:

12

PL 206 843 B1

- Substytucja proliny na alaninę w reszcie 41 (numeracja za Kabat 41) usuwa potencjalny epitop w reszcie nr 31 - Substytucja proliny na leucynę w reszcie 45 (numeracja za Kabat 45) usuwa potencjalny epitop w reszcie numer 43. Prolina w pozycji 45 znajduje się w VH sekwencji ludzkiej linii zarodkowej DP52. - Substytucja alaniny na izoleucynę w reszcie 48 (numeracja za Kabat 48) usuwa potencjalny epitop w reszcie numer 46. - Substytucja waliny za alaninę w reszcie 68 (numeracja za Kabat 67) usuwa potencjalny epitop w reszcie numer 58. - Substytucja izoleucyny za leucynę w reszcie 70 (numeracja za Kabat 69) usuwa potencjalny epitop w reszcie numer 62. - Substytucja treoniny za serynę w reszcie 91 (numeracja za Kabat 87) usuwa potencjalny epitop w reszcie numer 81 i 84. Substytucje aminokwasów konieczne do usunięcia potencjalnych epitopów z "oklejonego" 425 lekkiego łańcuch regionu zmiennego są następujące: - Substytucja histydyny na tyrozynę w reszcie 35 (numeracja za Kabat 36) usuwa potencjalny epitop w reszcie 27. - Substytucja alaniny za treoninę w reszcie 50 (numeracja za Kabat 51) usuwa potencjalny epitop w reszcie numer 43. Reszta ta występuje w obrębie CDR2. Alanina powszechnie znajduje się w tej pozycji zarówno w ludzkich jak i mysich przeciwciałach. Alternatywną substytucją w celu wyeliminowania tego epitopu jest substytucja alaniny na leucynę w pozycji 45 (numeracja za Kabat 46). Nie istnieje konserwatywna substytucja, która wyeliminuje potencjalny epitop. Alanina znajduje się w tej pozycji w niektórych przeciwciałach. - Substytucje proliny za izoleucynę w reszcie 94 (numeracja za Kabat 95) usuwa potencjalny epitop w reszcie numer 92. Reszta 95 według Kabat leży w obrębie CDRL3. Prolina jest powszechna w tej pozycji w sekwencjach mysiego przeciwciała i nie istnieje żadna zmiana poza ODR, która wyeliminuje potencjalny epitop. - Substytucja waliny za leucynę w reszcie 103 (numeracja za Kabat 104) usuwa potencjalny epitop w reszcie numer 93. 6. Projektowanie sekwencji deimmunizowanych. Deimmunizowane sekwencje ciężkiego i lekkiego łańcucha regionu zmiennego zostały określone w odniesieniu do zmian wymaganych do usunięcia potencjalnych epitopów limfocytów T i w oparciu o reszty sekwencji szkieletowej, które mogą być krytyczne dla struktury przeciwciała i wiązania. Oprócz deimmunizowanych sekwencji opartych na "oklejonych" sekwencjach dodatkowe zmiany zostały zaprojektowane dla każdego VH i VK w oparciu o mysią sekwencję, zakończoną odmianą Mysiego Peptydu Liniowego (MoPT) (ang. Mouse Peptide Threaded). Dla tej odmiany, zmiany zostały przeprowadzone bezpośrednio w sekwencji mysiej w celu wyeliminowania epitopów limfocytu T, oraz przeprowadzono jedynie zmiany poza CDR, które nie są uważane za znaczące dla wiązania. Nie przeprowadzono zmian w celu usunięcia powierzchniowych epitopów (limfocytów B) w tym przypadku deimmunizowanej sekwencji. Pierwszorzędowy deimmunizowany VH obejmuje substytucje od 1 do 6 w Sekcji 5 powyższego i nie obejmuje potencjalnych epitopów limfocytu T. Dalsze 4 deimmunizowane sekwencje VH były zaprojektowane w celu przetestowania efektu różnych substytucji wymaganych dla wiązania przeciwciała. Kumulatywne zmiany przeprowadzone w pierwszorzędowej deimmunizowanej sekwencji (425 VH1GRR-H-v1) i pozostałość potencjalnych epitopów limfocytu T są sprecyzowane w tabeli 2. Mysia odmiana liniowa została załączona w celu porównania. T a b e l a 2: Zmiany aminokwasu i potencjalnych epitopów w deimunizowanym 425 VH Odmiana

Kumulatywne zmiany reszty

Potencjalne epitopy limfocytów T

1

2

3

425 VH1GRR-VH-v1

brak

brak

425 VH1GRR -VH-v2

48A → I

46(8)

425 VH1GRR -VH-v3

45P → L

43(7), 46(8)

13

PL 206 843 B1

cd. tabeli 2 1

2

3

425 VH1GRR -VH-v4

67V → A, 69I → L

43(7), 46(8), 58(10), 62(11)

425 VH1GRR -VH-v5

41P → A

31(7), 43(7), 46(8), 58(10), 62(11)

Odmiana

Kumulatywne zmiany reszty

Potencjalne epitopy limfocytów T

425 VH-l\/IoPT

NA

43(7), 46(8)

Pierwotny deimmunizowany VK obejmuje substytucje od 1 do 4 w Sekcji 5 powyższego i nie obejmuje potencjalnych epitopów limfocytu T. Dalsze 4 deimmunizowane sekwencje VH były zaprojektowane w celu przetestowania efektu różnych substytucji wymaganych dla wiązania przeciwciała. Wersja 2 jest alternatywna do Wersji 1, w której alternatywna substytucja została zastosowana w celu usunięcia tych samych potencjalnych epitopów limfocytu T. Kumulatywne zmiany przeprowadzone w pierwszorzędowej deimmunizowanej sekwencji (425 L6-vg-VK-v1) i pozostałość potencjalnych epitopów limfocytu T są sprecyzowane w tabeli 3. Mysia odmiana liniowa została załączona w celu porównania. T a b e l a 3: Zmiany aminokwasu i potencjalnych epitopów w deimunizowanym 425 VK Odmiana

Kumulatywne zmiany reszty

Potencjalne epitopy limfocytów T

425 L6-vg-VK-v1

brak

brak

425 L6-vg-VK-v1

51A → T, 46L → A

brak

425 L6-vg-VK-v1

46A → L

43(16)

425 L6-vg-VK-v1

95P → I

43(16), 92(8)

425 L6-vg-VK-v1

36H → Y

27(5), 43(16), 92(8)

425VK-MoPT

NA

27(5), 43(16), 92(8)

T a b e l a 4: Oryginalne i "oklejone" sekwencje VH i VK z mysiego MAb-425 425 VH mysie QVQLQQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQRAGQGLEWIGEFNPSNGRTNYN EKFKSKATLTVDKSSSTAYMOLSSLTSEDSAVYYCASRDYDYDGRYF DYWGQGTTLTVSS 425 VK mysie QIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGPVRFSGS GSGTSYSLTISRMEAEDAATYYCQQWSSHIFTFGSGTKLEIK 425 VH "oklejony" (ang. veneered): QVQLVOSGAELVKPGASVKLSCKASGYTFTSHWMHWVKOAAGQGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYMQLSSLTSEDSAVYYCASRDYDYDGRYFDYWGQGTTLTVSS 425 VK "oklejony": QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGPARFSGS GSGTSYTLTISSLEAEDAATYYGQQWSSHIFTFGQGTKLEIK T a b e l a 5: Deimmunizowane sekwencje zmiennego ciężkiego i lekkiego łańcucha z MAb 425. 425 deimmunizowane VH1 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRTNY NEKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS 425 deimmunizowanego VK1 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGPARFSGS GSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK 425 deimmunizowane VH2 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS 425 deimmunizowane VK2 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK

14

PL 206 843 B1

425 deimmunizowane VH3 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRNYNE KFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS 425 deimmunizowane VK3 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK 425 deimmunizowane VH4 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGOGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYI\/IQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS 425 deimmunizowane VK4 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK 425 deimmunizowane VH5 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS 425 deimmunizowane VK5 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK 425 VH mysi peptyd liniowy (Mo PT) OVQLOQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRVTITVDKSSSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS 425 VK mysi peptyd liniowy (Mo PT) QIVLTQSPATLSASPGEKATMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTISRLEAEDAATYYCQQWSSHIFTFGQGTKVEIK Jak wcześniej zaznaczono, modyfikowane przeciwciała anty-EGFR według wynalazku, korzystnie MAb 425, mogą być zastosowane w kompozycjach farmaceutycznych i zestawach farmaceutycznych korzystnie w leczeniu raka. Terminy "rak" oraz "nowotwór" dotyczą lub opisują stan fizjologiczny u ssaków zwykle określany jako niekontrolowany wzrost komórek. Przy pomocy preparatów farmakologicznych według wynalazku mogą być leczone nowotwory takie, jak nowotwory piersi, serca, płuc, jelita cienkiego, okrężnicy, śledziony, nerek, pęcherza moczowego, głowy oraz szyi, jajników, prostaty, mózgu, trzustki, skóry, kości, szpiku kostnego, krwi, grasicy, cewki moczowej, jąder, szyjki macicy oraz wątroby. "Kompozycje farmaceutyczne" według wynalazku mogą zawierać, czynniki redukujące lub w ogóle eliminujące skutki uboczne związane ze skojarzoną terapią według wynalazku ("terapia wspomagająca"), włącznie, ale nie ograniczając się do nich z między innymi tymi czynnikami, które np. redukują toksyczne skutki leków przeciwrakowych, np. inhibitory resorpcji kości, czynniki kardioprotekcyjne. Wymienione pomocnicze czynniki chronią przed lub ograniczają przypadki nudności oraz wymiotów związane z chemioterapią, radioterapią lub operacją, lub redukują rozmiary infekcji związanej z podawaniem mielosupresywnych leków przeciwrakowych. Wspomagające czynniki są dobrze znane nauce. Zmodyfikowane przeciwciała według wynalazku mogą być dodatkowo podawane z takimi środkami wspomagającymi jak stymulatory systemu odpornościowego oraz BCG. Ponadto kompozycje te mogą zawierać czynniki immunoterapeutyczne lub-nie ma tego! Chemioterapeutyczne opisane powyżej, które zawierają radioaktywne izotopy o aktywności cytotoksycznej, lub inne cytotoksyczne czynniki, takie jak cytotoksyczne peptydy (np. cytokiny) lub cytotoksyczne leki itp. Termin "zestaw farmaceutyczny" do leczenia nowotworów lub przerzutów nowotworowych dotyczy pakietu i, z zasady, wskazówek użycia substancji czynnej w sposobie leczenia nowotworów oraz przerzutów nowotworowych. Substancja czynna w zestawie według wynalazku jest zwykle opracowana jako postać terapeutyczna tak jak to zostało opisane - i dlatego też może mieć dowolną z różnorodnych postaci nadających się do podawania w zestawie. Do takich postaci zalicza się ciecz, proszek, tabletki, zawiesinę oraz podobne formy służące dystrybucji antagonistów i/lub białek fuzyjnych według wynalazku. Substancje czynne mogą być dostarczone w osobnych zbiornikach dostosowanych do niezależnego podawania zgodnie z obecnymi standardami, lub alternatywnie mogą być dostarczane połączone w postaci kompozycji w pojedynczym zbiorniku w opakowaniu. Opakowanie może zawierać ilość wystarczającą na co najmniej jedną dawkę substancji czynnych zgodnie z niniejszym opisanymi metodami leczenia. Zestaw według wynalazku zawiera także "instrukcję stosowania" materiałów zawartych w opakowaniu. Użyte tutaj, określenia "farmaceutycznie tolerowany" oraz ich gramatyczne odmiany, odnoszące się

PL 206 843 B1

15

do związków chemicznych, nośników, rozcieńczalników oraz odczynników, są używane zamiennie i oznaczają, że dane materiały można podawać ssakom bez powodowania niepożądanych fizjologicznych skutków, takich jak nudności, zawroty głowy, problemy żołądkowe i tym podobnych. Technologia środków farmakologicznych zawierających rozpuszczone lub rozproszone aktywne składniki jest dobrze poznana i nie musi być stosowane tylko w oparciu o daną procedurę. Zwykle takie preparaty są przygotowywane jako zastrzyki, zarówno w postaci ciekłych roztworów jak i zawiesin, jednakże także stałe formy nadające się do sporządzenia przed użyciem roztworu lub zawiesiny w cieczy mogą także również być przygotowane. Preparaty te mogą także zostać zemulgowane. Aktywny składnik może zostać wymieszany z obojętnymi substancjami, które są farmaceutycznie tolerowane i zgodne z aktywnym składnikiem, w ilościach odpowiednich do zastosowania w metodach leczniczych tutaj opisanych. Odpowiednimi rozcieńczalnikami są, na przykład woda, roztwór soli fizjologicznej, dekstroza, glicerol, etanol i im podobne oraz ich mieszaniny. Dodatkowo, w razie potrzeby, preparat może zawierać niewielkie ilości substancji dodatkowych, takich jak czynniki zwilżające lub emulgujące, czynniki buforujące pH i im podobne, które zwiększają skuteczność czynnika aktywnego. Preparaty terapeutyczne według wynalazku mogą zawierać farmaceutycznie tolerowane sole powyższych składników. Zwykle, terapeutycznie efektywna dawka przeciwciała anty-EGFR jest tak dostosowaną dawką, iż podawana w fizjologicznie tolerowanym preparacie jest wystarczająca, aby osiągnięto stężenie w surowicy od około 0.01 mikrograma (μg) na mililitr (ml) do około 100 μg/ml, częściej od około 1 μg/ml do około 5 μg/ml, zwykle około 5 μg/ml. Innymi słowy, dawkowanie może wahać się od około 0.1 mg/kg do około 300 mg/kg, korzystnie od około 0.2 mg/kg do około 200 mg/kg, a najbardziej korzystnie od około 0.5 mg/kg do około 20 mg/kg, przy jednej lub większej liczbie podań dziennie przez jeden lub kilka dni. Z reguły niższe dawki niż wskazane powyżej mogą być zastosowane z tą samą wydajnością jeśli immunogenicznie modyfikowane przeciwciała według wynalazku są stosowane zamiast analogicznych nie-modyfikowanych odmian. W przypadku terapii łączonej, na przykład z czynnikiem chemioterapeutycznym, jest konieczne lub wskazane, że zwykle stosowana dawka takiego aktywnego czynnika wynosi od 10 mg do 1000 mg, korzystnie od około 20 do 200 mg, a najbardziej korzystnie od 50 do 100 mg na kilogram masy ciała dziennie. Poniższy przykład opisuje w zarysie sposób identyfikacji epitopów limfocytów T obecnych w normalnych przeciwciałach z nie-zmodyfikowanym potencjałem immunogenicznym według wynalazku. Identyfikacja rzeczonych sekwencji epitopu, może jednakże, być przeprowadzona znanymi sposobami jak te określone powyżej. PRZYKŁAD Istnieje wiele czynników, które odgrywają istotne role w określeniu całkowitej struktury białka lub polipeptydu. Po pierwsze, wiązanie peptydowe czyli wiązanie, które łączy razem aminokwasy w łańcuchu i jest wiązaniem kowalencyjnym. Wiązanie to posiada płaską strukturę, właściwą podstawionemu amidowi. Termin „amid" jest dowolną grupą cząsteczek organicznych zawierających grupę CONH-. Płaskie wiązanie peptydowe łączące atomy Cα sąsiednich aminokwasów może być przedstawione jak zobrazowano poniżej:

Ponieważ atomy O=C i C-N leżą na relatywnie sztywnej płaszczyźnie, nie występuje swobodna rotacja wokół tych osi. Stąd, płaszczyzna zilustrowana schematycznie za pomocą linii przerywanej określana jest czasem jako płaszczyzna „amidowa" lub „peptydowa", na której leżą atomy tlenu (O), węgla (C), azotu (N) i wodoru (H) głównego łańcucha peptydowego. W przeciwległych rogach płaszczyzny amidowej znajdują się atomy Cα. Ponieważ nie występuje zasadniczo żadna rotacja wokół atomów O=C i C-N w peptydzie albo płaszczyźnie peptydowej, łańcuch polipeptydowy składa się

16

PL 206 843 B1

zasadniczo z serii płaskich połączeń łączących atomy Cα. Drugi czynnik który odgrywa ważną rolę w określaniu całkowitej struktury lub konformacji polipeptydu czy białka, to kąt rotacji dla każdej płaszczyzny amidowej wokół wspólnego połączenia atomów Cα. Termin „kąt rotacji" lub „kąt skrętu" są tutaj traktowane jako terminy równoznaczne. Przyjmując że atomy O,C,N i H pozostają na płaszczyźnie amidowej (założenie to jest przeważnie słuszne, chociaż mogą istnieć drobne odchylenia od występowania tych atomów na jednej płaszczyźnie dla niektórych konformacji), takie kąty skrętu określają konformacje N i R głównego łańcucha polipetydowego, to znaczy strukturę jaka istnieje pomiędzy sąsiednimi resztami. Te dwa kąty są znane jako ϕ1 i ψ. Zbiór kątów ϕ1, ψ1, gdzie indeks dolny i przedstawia daną resztę łańcucha polipeptydowego, określa zatem efektywnie drugorzędową strukturę polipeptydu. Konwencje, które mają zastosowanie w określaniu kątów ϕ, ψ, przykładowo punktów odniesienia, w których płaszczyzny amidowe tworzą kąt zero stopniowy i określenie, który z kątów dla danego polipeptydu to kąt ϕ, a który kąt ψ, przedstawiono w literaturze. Patrz na przykład Ramachandran et al, Adv.Prot.Chem. 23:283-437 (1968), na stronach 285-94, które to strony załączono tutaj jako odnośnik. Sposób według wynalazku może mieć zastosowanie do dowolnego białka i bazuje częściowo na odkryciu, że u ludzi pozycja kotwicząca pierwszorzędowej Kieszonki 1 bruzdy wiążącej cząsteczki MHC klasy II ma dobrze określoną specyficzność dla poszczególnych bocznych łańcuchów aminokwasów. Specyficzność tej kieszonki jest określana poprzez tożsamość aminokwasu w pozycji 86 łańcucha beta cząsteczki MHC klasy II. Miejsce to znajduje się na spodzie Kieszonki 1 i określa rozmiar łańcucha bocznego który może być ulokowany w tej kieszonce. Marshall, K.W., J.Immunol., 152:4946-4956 (1994). Jeśli tą resztą jest glicyna, wówczas wszystkie hydrofobowe alifatyczne i aromatyczne aminokwasy (związkami hydrofobowymi alifatycznymi są: walina, leucyna, izoleucyna, metionina a aromatycznymi są: fenyloalanina, tyrozyna i tryptofan) mogą być ulokowane w kieszonce. Korzystne są aromatyczne łańcuchy boczne. Jeśli resztą kieszonki jest walina, wówczas boczny łańcuch aminokwasu wystaje do wnętrza kieszonki i ogranicza rozmiar łańcuchów bocznych, które mogą być tam ulokowane, tak że tylko hydrofobowe alifatyczne łańcuchy boczne mogą zostać ulokowane. Zatem, w sekwencji reszt aminokwasów, gdziekolwiek znajduje się aminokwas z hydrofobowym alifatycznym lub aromatycznym łańcuchem bocznym, istnieje możliwość, że epitop restrykcyjny limfocytu T cząsteczki MHC klasy II będzie prezentowany. Jeśli boczny łańcuch jest hydrofobowy i alifatyczny wówczas, istnieje dwukrotnie większe powinowactwo do epitopu limfocytu T niż w przypadku aromatycznego łańcucha bocznego (nawet uwzględniając w przybliżeniu występowanie typów Kieszonki 1 w populacji globalnej). Metoda obliczeniowa będąca realizują wynalazku określa prawdopodobieństwo, że regiony białka będą zawierały epitopy limfocytu T w następujący sposób: (1) Pierwszorzędowa sekwencja segmentu peptydowego o założonej długości jest skanowana, i identyfikowane są wszystkie obecne hydrofobowe alifatyczne i aromatyczne łańcuchy boczne. (2) Hydrofobowym alifatycznym bocznym łańcuchom przypisuje się wyższą wartość niż aromatycznym łańcuchom bocznym, korzystnie wartość dwukrotnie wyższą, na przykład wartość 2 dla hydrofobowych alifatycznych łańcuchów bocznych i wartość 1 dla aromatycznych łańcuchów bocznych. (3) Określone wartości są sumowane dla każdego nakładającego się segmentu (okna) reszt aminokwasów o założonej jednakowej długości w obrębie peptydu, i całkowita wartość dla danego segmentu (okna) przypisana jest do pojedynczej reszty aminokwasu w środkowej pozycji segmentu (okna), korzystnie reszcie w okolicach punktu środkowego analizowanego segmentu (okna). Procedura ta jest powtarzana dla każdego wziętego do analizy nakładającego się segmentu (okna) reszt aminokwasów. Stąd każdej reszcie aminokwasu jest przypisana wartość, która odnosi się do prawdopodobieństwa występowania epitopu limfocytu T w danym segmencie (oknie). (4) Wartości wyliczone i przypisane jak opisano w etapie 3 powyżej, mogą zostać zobrazowane na wykresie współrzędnych aminokwasu dla całej sekwencji reszt aminokwasów, która była szacowana. (5) Wszystkie fragmenty sekwencji, które mają punktacje o założonej wartości, przykładowo wartości 1, są uważane za zawierające epitopy limfocytu T i jeśli właściwe, mogą być zmodyfikowane. Ten szczególny aspekt obecnego wynalazku dostarcza ogólnego sposobu, za pomocą którego mogą zostać opisane regiony peptydu prawdopodobnie zawierające epitopy limfocytu T. Modyfikacje peptydu w tych regionach dają możliwość modyfikacji charakterystyki wiązania MHC klasy II. Według innego aspektu obecnego wynalazku, epitopy limfocytu T mogą być określone z większą precyzją z zastosowaniem złożonych metod obliczeniowych, które prowadzą do oceny interakcji peptydów z modelami alleli MHC klasy II. Komputerowe przewidywanie epitopów występujących

PL 206 843 B1

17

w peptydzie według tego szczególnego aspektu, uwzględnia konstrukcję modeli dla przynajmniej 42 alleli MHC klasy II opartej na strukturach znanych cząsteczek MHC klasy II oraz sposób zastosowania tych modeli w komputerowej identyfikacji epitopów limfocytów T, konstrukcję bibliotek głównych łańcuchów peptydowych dla każdego modelu w celu uwzględnienia znanej różnorodności w odpowiednich pozycjach atomu węgla alfa Ca głównego łańcucha peptydowego, konstrukcję bibliotek konformacji bocznych łańcuchów aminokwasu dla każdego głównego przyłączenia z poszczególnym modelem dla każdego z możliwych 20 aminokwasów w pozycjach znaczących dla interakcji między peptydem a cząsteczką MHC klasy II, i zastosowanie tych bibliotek konformacji głównych i bocznych łańcuchów w połączeniu z funkcją punktacyjną (ang. scoring function) dla wyboru optymalnej konformacji łańcucha głównego i bocznego dla poszczególnego peptydu przyłączonego do danej cząsteczki MHC klasy II i wyprowadzenie punktacji wiązania dla tego oddziaływania. Modele cząsteczek MHC klasy II mogą być wyprowadzone poprzez modelowanie homologii z wielu podobnych struktur znajdujących się w Banku Danych dla Białek w Brookhaven (Brookhaven Protein Data Bank - PDB). Może to zostać osiągnięte poprzez zastosowanie półautomatycznego oprogramowania modelującego homologię (Modeller, Sali A. & Blundell TL., 1993. J.Mol Biol 234:779-815). które zawiera funkcje symulowanego wyżarzania, w połączeniu z CHARMm pola siłowego dla minimalizacji energii (dostępny poprzez Molecular Simulation Inc., San Diego, Ca.). Alternatywne metody modelowania mogą być także zastosowane. Obecna metoda różni się znacząco od innych metod obliczeniowych, które wykorzystują biblioteki danych dotyczących wiązań otrzymanych eksperymentalnie dla każdego aminokwasu, alternatywnie dla każdej pozycji w bruździe wiążącej dla małego zbioru cząsteczek MHC klasy II (Marshall, K.W. et al, Biomed. Pept. Proteins Nucleic Acids, 1(3):157-162) (1995), lub jeszcze innych metod obliczeniowych, które wykorzystują podobne dane eksperymentalne dotyczące wiązania, w celu określenia właściwości wiązania poszczególnych typów wiążących kieszonek w obszarze bruzdy, ponownie z wykorzystaniem względnie małego podzbioru cząsteczek MHC klasy II, a następnie „przestawiając i dopasowując" typy kieszonki z tej biblioteki kieszonek do sztucznie stworzonych kolejnych „wirtualnych" cząsteczek MHC klasy II (Sturniolo T. et al, Nat.Biotech, 17(6): 555-561 (1999). Obie wcześniejsze metody wykazują główną wadę, jaką jest to, iż z powodu złożoności metod i potrzeby generowania ogromnej liczby wariantów peptydów, tylko niewielka liczba cząsteczek MHC klasy II może być eksperymentalnie przeskanowana. Dlatego też pierwsza z powyższych metod może jedynie przeprowadzać prognozy dla małej liczby cząsteczek MHC klasy II. Druga z powyższych metod, także zakłada że utworzona z podobnych aminokwasów kieszonka w jednej cząsteczce będzie miała podobne właściwości wiązania jak w odniesieniu do różnych alleli klasy II i metoda ta wykazuje dalsze wady, ze względu na to, że tylko te cząsteczki MHC klasy II mogą być „wirtualnie" stworzone, które zawierają kieszonki zawarte w bibliotece kieszonek. Stosując podejście modelowe opisane tutaj, struktura każdej liczby i typu cząsteczek MHC klasy II może być wywnioskowana, zatem allele mogą być specyficznie wybrane aby odpowiadać całej populacji. Dodatkowo, liczba cząsteczek MHC klasy II przeglądanych może być zwiększona bardziej poprzez przeprowadzenie kolejnych modeli, niż poprzez konieczność generowania dodatkowych danych poprzez złożone doświadczenia. Zastosowanie biblioteki łańcuchów głównych uwzględnia zróżnicowanie w położeniach atomów Cα różnych peptydów skanowanych w czasie, kiedy są połączone z konkretnymi cząsteczkami MHC klasy II. Także i to jest przeciwne do alternatywnych znanych metod obliczeniowych opisanych powyżej, które polegają na wykorzystaniu uproszczonych łańcuchów głównych peptydu, dla poszukiwania wiązania aminokwasów w poszczególnych kieszonkach. Nie ma możliwości, aby te uproszczone łańcuchy były reprezentatywne dla konformacji łańcucha głównego występującego w „prawdziwych" peptydach, co prowadzi do braku precyzji w przewidywaniu wiązania peptydów. Obecna biblioteka łańcuchów głównych jest tworzona poprzez nakładanie łańcuchów głównych wszystkich białek związanych z cząsteczkami MHC klasy II znajdującymi się w Banku Danych o Białkach (PDB) i rejestrowanie średniego odchylenia kwadratowego (ang. root mean square - RMS) pomiędzy atomami Cα każdego z jedenastu aminokwasów umieszczonych w bruździe wiążącej. Podczas gdy biblioteka ta może być wyprowadzona z małej liczby odpowiednich i dostępnych mysich i ludzkich struktur (obecnie 13), dla uwzględnienia możliwości nawet większej różnorodności, wartość RMS dla każdej pozycji C"-α jest zwiększana o 50%. Średnia pozycja Cα każdego aminokwasu jest wówczas określana i wykreślona zostaje sfera wokół tego punktu, której promień równa się odchyleniu RMS dla tej pozycji plus 50%. Sfera ta reprezentuje wszystkie dopuszczalne pozycje Cα.

18

PL 206 843 B1

Wychodząc z Cα o najmniejszym odchyleniu RMS (z aminokwasu w Kieszonce 1 jak zaznaczono powyżej, równoważnej Pozycji 2 z 11 reszt w bruździe wiążącej) sfera zostaje trójwymiarowo usieciowana, a każdy węzeł sieci jest zastosowany jako możliwa lokalizacja dla Cα tego aminokwasu. Kolejna płaszczyzna amidowa, odpowiadająca wiązaniu peptydowemu sąsiedniego aminokwasu jest przyczepiana do każdego z tych atomów Cα a kąty ϕ oraz ψ są obracane stopniowo o ustalone interwały w celu ustawienia sąsiedniego atomu Cα. Jeżeli sąsiedni atom Cα wchodzi w zakres „sfery dozwolonych pozycji" dla takiego Cα położenie dipeptydu jest akceptowane, podczas gdy wypada on poza sferą wtedy dipeptyd jest odrzucany. Proces ten jest powtarzany dla każdej sąsiedniej pozycji Cα, tak że peptyd rośnie od „ziarna" Cα Kieszonki 1, aż wszystkie 9 kolejnych atomów Cα zostanie ustawionych dla wszystkich możliwych permutacji poprzedniego Cα. Proces jest powtarzany ponownie dla pojedynczego Cα poprzedzającego Kieszonkę 1, aby utworzyć bibliotekę pozycji Cα łańcucha głównego zlokalizowanych w obrębie bruzdy wiążącej. Wygenerowana liczba łańcuchów głównych zależy od kilku czynników: Rozmiarów „sfer dozwolonych pozycji", stopnia złożoności usieciowania „sfery pierwszorzędowej" w pozycji Kieszonki 1; stopnia złożoności stopniowej rotacji kątów ϕ oraz ψ zastosowanej do ułożenia sąsiednich atomów Cα. Stosując ten proces można utworzyć ogromną bibliotekę łańcuchów głównych. Im większa jest biblioteka łańcuchów głównych, tym bardziej prawdopodobne, że dla danego peptydu optymalne dopasowanie zostanie znalezione w obszarze bruzdy wiążącej cząsteczki MHC klasy II. O ile wszystkie łańcuchy główne nie będą odpowiednie pod względem przyłączania dla wszystkich modeli cząsteczek MHC klasy II z powodu kolizji z aminokwasami domeny wiążącej, dla każdego allelu jest tworzona podjednostka biblioteki zawierająca łańcuchy główne, które mogą być ulokowane przez ten allel. Zastosowanie biblioteki łańcuchów głównych, w połączeniu z modelami cząsteczek MHC klasy II stwarza wyczerpującą bazę danych składającą się z dopuszczalnych konformacji łańcucha bocznego dla każdej pozycji bruzdy wiążącej dla każdej cząsteczki MHC klasy II połączonej z każdym z możliwych łańcuchów głównych. Ten zbiór danych jest generowany przy zastosowaniu prostej sferycznej funkcji zachodzenia, w której cząsteczka MHC klasy II połączona jest z głównym łańcuchem a boczny łańcuch aminokwasowy doczepiony jest do łańcucha głównego w pożądanej pozycji. Każde zdolne do obrotu wiązania łańcucha bocznego, obracane są stopniowo o ustalone interwały a ostateczne pozycje atomów należące od tego wiązania zostają odnotowane. Oddziaływanie atomu z atomami łańcucha bocznego bruzdy wiążącej jest odnotowane i pozycje są albo akceptowane albo odrzucane według następujących kryteriów: Całkowita suma zachodzenia wszystkich atomów dotąd ustawianych nie może przekraczać z góry założonej wartości. Zatem przejrzystość poszukiwania konformacji jest funkcją interwału zastosowanego w stopniowej rotacji wiązania i założonej z góry granicy dla całkowitego zachodzenia. Ta druga wartość może być mała, jeśli jest wiadome, że dana kieszonka jest sztywna, jednak przejrzystość może być osłabiona jeśli wiadomo, że pozycje łańcuchów bocznych kieszonki są względnie elastyczne. Zatem mogą być opracowane poprawki, aby odwzorować różnice w elastyczności w obrębie kieszonek bruzdy wiążącej. Takie poszukiwanie konformacji jest potem powtarzane dla każdego aminokwasu w każdej pozycji każdego łańcucha głównego, który jest połączony z każdą z cząsteczek MHC klasy II w celu stworzenia wyczerpującej bazy danych konformacji łańcucha bocznego. Zastosowano odpowiednie matematyczne wyrażenie, aby wyznaczyć energię modeli cząsteczek MHC klasy II w połączeniu z konformacjami ligandu peptydu, który ma być empirycznie wyprowadzony poprzez przeglądanie ogromnej bazy danych konformacji głównych/bocznych łańcuchów opisanej powyżej. Zatem białko jest przeszukiwane w kierunku potencjalnych epitopów limfocytów T z uwzględnieniem każdego możliwego peptydu o długości różniącej się od 9 do 20 aminokwasów (chociaż długość jest stała dla każdego przeszukiwania) z zastosowaniem następujących obliczeń: Cząsteczka MHC klasy II jest wybierana łącznie z łańcuchem głównym peptydu uwzględnionym dla tej cząsteczki a boczne łańcuchy odnoszące się do pożądanej sekwencji peptydu są przyłączane. Identyfikacja atomu i odległość międzyatomowa związana z konkretnym bocznym łańcuchem w konkretnej pozycji w łańcuchu głównym, są zbierane dla każdej dozwolonej konformacji tego aminokwasu (otrzymanej z bazy danych opisanej powyżej). Procedura ta jest powtarzana dla każdego bocznego łańcucha wzdłuż łańcucha głównego i z zastosowaniem funkcji punktacyjnej otrzymuje się punkty odnoszone do peptydu. Najlepsza punktacja dla tego łańcucha jest zachowywana a proces powtarzany dla każdego łańcucha głównego z wybranego modelu. Wyniki wszystkich dozwolonych łańcuchów głównych są porównywane, a najwyższy wynik jest uważany za wynik peptydu dla pożądanego peptydu w tym modelu MHC klasy II. Proces ten jest powtarzany dla każdego modelu z każdym możliwym

PL 206 843 B1

19

peptydem pochodzącym z białka poddanego przeglądaniu i przedstawia się punktacje dla peptydów w funkcji modelów. Według wynalazku, każdy ligand poddany obliczeniom powinowactwa wiązania jest segmentem aminokwasowym wybranym z peptydu lub białek jak omówiono powyżej. Zatem ligand jest wybranym odcinkiem aminokwasów długości około 9 do 20 aminokwasów pochodzącym z peptydu, polipeptydu lub białek o znanej sekwencji. Terminy „aminokwas" i „reszta" są tutaj traktowane jako terminy równoważne. Ligand w postaci kolejnych aminokwasów peptydu, który ma być zbadany, po przyczepieniu do łańcucha głównego wybranego z biblioteki łańcuchów głównych, jest umiejscawiany w bruździe wiążącej cząsteczek MHC klasy II z biblioteki modeli cząsteczek MHC klasy II poprzez współrzędne atomów C"-α łańcucha głównego peptydu a dopuszczalna konformacja każdego łańcucha bocznego jest wybierana z bazy dopuszczalnych konformacji. Odpowiednie tożsamości atomu i odległości między atomowe są także wyszukiwane z tej bazy i stosowane do obliczenia wartości wiązania dla peptydu. Ligandy o wysokim powinowactwie wiązania do wiążącej kieszonki MHC klasy II są oznaczane jako pretendenci do ukierunkowanej mutagenezy. Substytucja aminokwasu jest przeprowadzana w oznaczonym ligandzie (i stąd także w białku leżącym w zakresie zainteresowania) który jest potem ponownie testowany przy zastosowaniu funkcji punktacyjnej dla określenia zmian, które obniżają powinowactwo wiązania poniżej założonej z góry wartości progowej. Zmiany te mogą zatem być wbudowane w białko będące przedmiotem zainteresowania w celu usunięcia epitopów limfocytów T. Wiązanie między ligandem peptydu a bruzdą wiążącą cząsteczek MHC klasy II obejmuje niekowalencyjne oddziaływania włączając, ale nie ograniczając do: wiązań wodorowych, oddziaływań elektrostatycznych, hydrofobowych (lipofilowych) oddziaływań i oddziaływań Van der Waalsa. Są one zawarte w funkcji punktacyjnej jak opisano szczegółowo powyżej. Należy rozumieć, że wiązanie wodorowe jest wiązaniem niekowalencyjnym, które może zostać utworzone pomiędzy polarnymi lub naładowanymi grupami i składa się z atomu wodoru dzielonego przez dwa inne atomy. Wodór dawcy wodoru ma ładunek dodatni podczas gdy akceptor wodoru ma częściowy ładunek ujemny. W kontekście oddziaływań peptyd/białko, donorami w wiązaniu wodorowym mogą być albo atomy azotu z przyłączonym atomem wodoru lub atomy wodoru przyłączone do atomu tlenu lub azotu. Atomami akceptorowymi w wiązaniu wodorowym mogą być atomy tlenu nie przyłączone do atomu wodoru, atomy azotu bez przyłączonych atomów wodoru i z jednym lub dwoma połączeniami, lub atomy siarki tylko z jednym połączeniem. Pewne atomy główne, takie jak atomy tlenu przyłączone do atomu wodoru lub atomy azotu imin (przykład C=NH) mogą być zarówno akceptorami jak i donorami wodoru. Energia wiązania wodorowego waha się od 3 do 7 Kcal/mol i jest o wiele silniejsza niż w wiązaniach Van der Waalsa, ale słabsza niż w wiązaniach kowalencyjnych. Wiązania wodorowe są wysoce zorientowane przestrzennie i są najsilniejsze wówczas, kiedy atom donorowy, atom wodoru i akceptor leżą na jednej linii. Elektrostatyczne wiązania powstają między przeciwnie naładowanymi parami jonowymi i siła oddziaływania jest odwrotnie proporcjonalna do kwadratu odległości zgodnie z prawem Coulomba. Optymalna odległość między parami jonowymi wynosi około 2,8Å. W oddziaływaniach białko/peptyd, elektrostatyczne wiązania mogą powstawać pomiędzy argininą, histydyną lub lizyną a asparginianem lub glutaminianem. Siła wiązania zależy od wartości pKa zjonizowanej grupy i stałej dielektrycznej środowiska, chociaż jest w przybliżeniu zbliżona w sile do wiązania wodorowego. Lipofilowe oddziaływania są korzystnymi hydrofobowo-hydrofilowymi oddziaływaniami, które występują między białkiem a ligandem peptydowym. Przeważnie, występuje pomiędzy hydrofobowym łańcuchem bocznym aminokwasu peptydu schowanego we wnętrzu kieszonek bruzdy wiążącej, w taki sposób że nie są one narażone na rozpuszczalnik. Narażenie reszt hydrofobowych na rozpuszczalnik jest wysoce niekorzystne, gdyż otaczające cząsteczki rozpuszczalnika są wciskane w wiązanie wodorowe wspólnie tworząc klatkowe struktury klatratowe. Wynikający stąd spadek entropii jest wysoce niekorzystny. Atomami lipofilowymi mogą być atomy siarki, które nie są ani polarne ani nie są akceptorami wodoru oraz atomy węgla które nie są polarne. Wiązania Van der Waalsa są niespecyficznymi siłami występującymi między atomami znajdującymi się w odległości 3-4 Å. Są one słabsze i mniej specyficzne niż wiązania wodorowe i wiązania elektrostatyczne. Rozmieszczenie ładunku elektrycznego wokół atomu zmienia się w czasie, i w każdej chwili nie jest symetryczne. Nietrwała asymetria w ładunku elektrycznym indukuje podobną asymetrię w sąsiednich atomach. Powstałe siły przyciągania pomiędzy atomami osiągają maksimum w odległości kontaktu Van der Waalsa, ale zmniejszają się bardzo gwałtownie od 1Å do 2Å. Odwrotnie, gdy atomy zostają rozdzielone na odległość mniejszą niż odległość kontaktu wzrastające silne siły odpychające stają się dominujące w momencie kiedy zewnętrzne chmury elektronowe nakładają się.

20

PL 206 843 B1

Chociaż siły przyciągania są relatywnie słabe w porównaniu do elektrostatycznych i wodorowych wiązań (około 0,6 Kcal/mol), jednak odpychające siły zasadniczo mogą odgrywać bardzo ważną rolę w określeniu czy ligand peptydowy może pomyślnie wiązać się z białkiem. W jednej realizacji, funkcja punktacyjna Böhma (podejście SCORE1) jest stosowana do określenia stałej wiązania (Böhm, H.J., J.Comput Aided Mol. Des., 8(3):243-256 (1994), co niniejszym dołącza się tu całkowicie). W innej realizacji, funkcja punktacyjna (podejście SCORE2) jest używana aby wyznaczyć powinowactwo wiązania jako wskaźnik ligandu zawierającego epitop limfocytu T (Böhm, H.J., J.Comput Aided Mol. Des., 12(4):309-323 (1998) co niniejszym dołącza się tu całkowicie). Jednakże funkcja punktowa Böhma, jak opisano w powyższych odnośnikach, jest stosowana do wyznaczenia powinowactwa wiązania ligandu do białka gdzie, choć jest z góry wiadome, że ligand pomyślnie wiąże się z białkiem a kompleks białko/ligand ma swoją strukturę rozwiązaną, która to struktura jest obecna w Banku Danych o Białkach (PDB). Dlatego też funkcja punktowa została opracowana w oparciu o znane dane dotyczące dodatnich wiązań. Aby uwzględnić rozróżnienie pomiędzy dodatnimi a ujemnymi substancjami wiążącymi, parametr odpychania musi być dodany do równania. Dodatkowo, bardziej zadawalające określenie energii wiązania zostaje osiągnięte poprzez obliczenie lipofilowych oddziaływań sposobem parowania, niż stosując wyraz energii powierzchniowej, jak w powyższych funkcjach Böhma. Zatem, w korzystnej realizacji, energia wiązania jest określona przy zastosowaniu zmodyfikowanej funkcji punktacyjnej Böhma. W zmodyfikowanej funkcji punktacyjnej Böhma, energia wiązania pomiędzy białkiem a ligandem (ΔGbind) jest określona w oparciu o następujące parametry: redukcja energii wiązania z powodu całkowitej utraty entropii translokacyjnej i rotacyjnej ligandu (ΔG0); udział doskonałych wiązań wodorowych (ΔGhb), gdzie przynajmniej jeden składnik jest obojętny; udział niezaburzonych oddziaływań jonowych (ΔGionic); lipofilowych oddziaływań pomiędzy atomami lipofilowego ligandu i atomami lipofilowego akceptora (ΔGlipo); utrata energii wiązania z powodu zamrożenia wewnętrznych stopni swobody w ligandzie, przykładowo swoboda rotacji wokół każdego C-C wiązania jest ograniczona (ΔGrot); energia oddziaływania pomiędzy białkiem a ligandem (EVdW)- Zależność tych terminów daje równanie 1: (ΔGbind) = (ΔG0) + (ΔGhbxNhb) + (ΔGionicxNionic) + (ΔGlipoxNlipo) + (ΔGrotxNrot) + (EVdW) Gdzie N jest liczbą wskaźnikowych oddziaływań dla określonego wyrazu i w jednej realizacji, ΔG0, ΔGhb, ΔGionic, ΔGlipo i ΔGrot są stałymi wyrażonymi wartościami wartościami wynoszą odpowiednio: 5.4, -4.7, -4.7, -0.17 i 1.4. Wyraz Nhb jest wyliczany w oparciu o równanie 2: Nhb = Σh-bonds f(ΔR,Δα) x f(Nneighb) x fpcs f(ΔR,Δα) jest funkcją kary (ang. penalty function), którą oblicza się dla dużych odchyleń wiązań wodorowych od stanu doskonałego i wylicza według równania 3: f(ΔR, Δ-α) = f1(ΔR) x f2 f(Δα) gdzie: f1 (ΔR) =1 jeśli ΔR 10 Å2 Apolar jest rozmiarem powierzchni płaszczyzny polarnego styku białko - ligand NHB jest liczbą wiązań wodorowych β jest stałą o wartości = 1.2 Dla zastosowania zmodyfikowanej funkcji punktowej Böhma, udziały jonowych oddziaływań, ΔGjonowe, są wyliczane w podobnym stylu do tych dla wiązań wodorowych opisanych powyżej, jeśli przyjmie się taką samą zależność geometryczną. Wyraz Nlipo jest wyliczany w oparciu o poniższe równanie 5: Nlipo = ΣILf(rIL) f(rIL) jest wyliczana dla wszystkich atomów lipofilowego ligandu, I, i dla wszystkich atomów białka lipofilowego, L, według następujących kryteriów: f(rIL) = 1 gdy rIL< = R1 f(rIL) = f(rIL) - R1) / (R2 - R1 ) gdy R2 < rIL > R1 f(rIL) = 0 gdy rIL > = R2 Gdzie: R1 =rIvdw + rLvdw + 0.5 i R2 = R1 + 3.0, rIvdw jest promieniem Van der Waalsa atomu I a rLvdw jest promieniem Van der Waalsa atomu L Wyraz Nrot jest liczbą zdolnych do obrotu wiązań aminokwasu bocznego łańcucha i przyjętą jako liczba acyklicznych wiązań sp3-sp3 oraz sp3-sp3. Obroty terminalnej grupy -CH3 lub NH3 nie są brane pod uwagę. Końcowy wyraz, EVdW, jest wyliczany według równania 6 przedstawionego poniżej: EVdW = ε1ε2 ((r1vdw – r2vdw)12 / r12 – (r1vdw + r2vdw)6 / r6), gdzie ε1 i ε2 są stałymi zależnymi od tożsamości atomu r1vdw+ r2vdw są promieniami atomowymi Van der Waalsa r jest odległością między parą atomów Ze względu na równanie 6, w jednej realizacji wynalazku, stałe ε1 i ε2 nadają atomom wartości: 0:0.245, N:0.283, 0:0.316, S:0.316, odpowiednio (przykłady odpowiednio dla atomów węgla, azotu, tlenu i siarki). Ze względu na równania 5 i 6, promienie Van der Waalsa nadają atomom wartości: 0:1.85, N:1.75, 0:1.60, S:2.00Å. Należy rozumieć, że wszystkie założone wartości i stałe podane w powyższych równaniach są określone względem obecnego stanu wiedzy o oddziaływaniach ligandów białek ze szczególnym odniesieniem do typu obliczeń jakie zostały przyjęte. Dlatego też możliwe jest, że jeśli funkcja punktacyjną będzie dalej przedefiniowywana, te wartości i stałe mogą się zmienić, dlatego tez dowolne odpowiednie wartości numeryczne, które dają pożądane wyniki w wyrazach wyznaczających energie wiązania białka do ligandu, mogą być zastosowane i tym samym wchodzą w obszar wynalazku. Jak opisano powyżej, funkcja punktacyjna ma zastosowanie do danych otrzymanych z bazy danych o konformacjach łańcucha bocznego, rodzajów atomów, i odległości międzyatomowych. Dla celów obecnego opisu, liczba cząsteczek MHC klasy II zawartych w tej bazie wynosi 42 modele plus cztery rozwiązane struktury. Oczywistym jest na podstawie powyższych opisów, że zmienna natura konstrukcji metody obliczeniowej według wynalazku oznacza, że nowe modele mogą być łatwo dodane i przeglądane z zastosowaniem biblioteki łańcuchów głównych peptydów oraz funkcji poszukiwania konformacji bocznego łańcucha, dla utworzenia dodatkowego zbioru danych, który może być przetwarzany przez funkcję punktową dla peptydu jak opisano powyżej. Umożliwia to łatwe powiększanie zestawu przeglądanych cząsteczek MHC klasy II lub struktur i zastępowanie powiązanych danych, jeśli będą dostępne dane do stworzenia bardziej dokładnych modeli istniejących alleli. Obecna metoda prognozowania może być kalibrowana na zespół danych zawierający dużą liczbę peptydów, których powinowactwo do różnych cząsteczek MHC klasy II zostało wcześniej eksperymentalnie określone. Porównując wyliczone i doświadczalne dane, może zostać określona graniczna wartość, powyżej której wiadomo, że wszystkie eksperymentalnie określone epitopy limfocytów T są prawidłowo przewidziane.

22

PL 206 843 B1

Należy rozumieć że, chociaż powyższa funkcja punktacyjna jest względnie łatwo porównywana do niektórych wyspecjalizowanych znanych metod, obliczenia są wykonywane nader szybko. Należy także rozumieć, że celem nie jest wyliczenie prawdziwej energii wiązania per se dla każdego peptydu przyłączonego do bruzdy wiążącej wybranego białka MHC klasy II. Wyraźnym celem jest otrzymanie porównywalnych danych dotyczących energii wiązania jako pomocy w przewidywaniu lokalizacji epitopów limfocytów T w oparciu o strukturę pierwszorzędową (to znaczy sekwencje aminokwasów) wybranego białka. Względnie wysoka energia wiązania lub energia wiązania powyżej wybranego progu może sugerować obecność epitopu limfocytu T w ligandzie. Ligand może być wtedy poddany przynajmniej jednemu cyklowi substytucji aminokwasu i energia wiązania ponownie wyliczona. Ze względu na szybką naturę tych obliczeń, manipulacje z sekwencją peptydu mogą być przeprowadzone interaktywnie przez interfejs użytkownika programu na niedrogim sprzęcie komputerowym. Większe inwestycje w sprzęt komputerowy nie są tu wymagane. Dla znawcy techniki oczywistym jest, że do tych samych celów można także zastosować inne dostępne oprogramowanie. W szczególności, bardziej wyspecjalizowane oprogramowanie, które zdolne jest przyłączać ligandy do wiążących miejsc białka może być zastosowane łącznie z minimalizacją energii. Przykładami oprogramowania przyłączającego (ang. docking software) są: DOCK (Kuntz et al, J.Mol.Biol., 161:269-288 (1982)), LUDI (Böhm, H.J., J.Comput Aided Mol.Des., 8:623-632 (1994)) oraz FLEXX (Rarey M. et al, ISMB, 3:300-308 (1995)). Przykłady oprogramowania przeznaczonego do modelowania molekularnego i manipulowania obejmują: AMBER (Tripos) i CHARMm (Molecular Simulations Inc.). Zastosowanie tych metod obliczeniowych może znacząco ograniczyć przepustowość sposobu według wynalazku z powodu długości czasu obróbki wymaganego do przeprowadzenia koniecznych obliczeń. Jednakże, możliwe jest zastosowanie takich metod jako „przeglądu drugorzędowego", dla otrzymania bardziej dokładnych obliczeń energii wiązania peptydów, które są traktowane jako „dodatnie cząsteczki wiążące" przez sposób według wynalazku. Ograniczenia związane z czasem obróbki dla złożonych obliczeń molekularno-mechanicznych i molekularno-dynamicznych są określone zarówno przez projekt oprogramowania przeprowadzającego te obliczenia, jak i współczesne ograniczenia technologiczne sprzętu komputerowego. Można oczekiwać, że w przyszłości, poprzez stworzenie bardziej wydajnego kodu i stałego wzrostu szybkości procesorów komputerowych, można będzie osiągnąć przeprowadzenie takich obliczeń w bardziej elastycznych ramach czasowych. Dalsze informacje dotyczące funkcji energii zastosowanych do makromolekuł i rozważania dotyczące różnych oddziaływań, które mają miejsce w złożonych strukturach białkowych można znaleźć w: Brooks, B.R. et al, J.Comput.Chem., 4:187-217 (1983), a dalsze informacje dotyczące ogólnych oddziaływań białko-ligand można znaleźć w: DauberOsguthorpe et al, Proteins 4(1):31-47 (1988), które załączono tu w całości jako odniesienia. Użyteczne podstawowe informacje można również znaleźć w, na przykład Fasman, G.D., Prediction of Protein Structure and Princilia of Protein Conformation, Plenum Press, New York, ISBN: 0-306 4313-9.

Zastrzeżenia patentowe 1. Zmodyfikowane przeciwciało lub jego fragment wybrany z grupy obejmującej fragmenty Fab, Fab', F(ab')2, Fv i Fc, dimery przeciwciał, liniowe przeciwciała, cząsteczki przeciwciał jednołańcuchowych i wielospecyficzne przeciwciała ukształtowane z fragmentu (fragmentów) przeciwciała, skierowany na receptor EGF (Her 1) pochodzący od mysiego przeciwciała 425 i zawierający, w porównaniu do oryginalnego immunogenicznie niezmodyfikowanego przeciwciała, zredukowaną liczbę sekwencji epitopów limfocytu T, które są ligandami MHC klasy II lub sekwencjami peptydowymi wykazującymi zdolność do stymulowania lub wiązania komórek T poprzez prezentację na cząsteczce klasy II, i będące zasadniczo nieimmunogenne lub mniej immunogenne niż jakiekolwiek oryginalne immunogenicznie niezmodyfikowane przeciwciało skierowane na ten sam receptor podczas narażenia na system immunologiczny danego gatunku, znamienne tym, że rzeczone zmodyfikowane przeciwciało zawiera sekwencje VH i VK wybrane z grupy obejmującej: sekwencję VH1: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRTNY NEKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS sekwencję VK1: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK

PL 206 843 B1

23

sekwencję VH2: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK2: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH3: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK3: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH4: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRATLWDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK4: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK sekwencję VH5: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYN EKFKSRATLWDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK5: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK. 2. Zmodyfikowane przeciwciało według zastrz. 1, znamienne tym, że rzeczone oryginalne immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem chimerycznym. 3. Zmodyfikowane przeciwciało według zastrz. 1, znamienne tym, że rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem nie pochodzącym od człowieka, zawierającym reszty powierzchniowe za wyjątkiem tych nie będących w pobliżu regionów CDR, które pochodzą z odpowiednich ludzkich referencyjnych sekwencji szkieletowych. 4. Zmodyfikowane przeciwciało według zastrz. 1, znamienne tym, że rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem mysim mAb 425. 5. Sekwencja DNA, kodująca ciężki i/lub lekki łańcuch zmodyfikowanego przeciwciała zdefiniowanego w dowolnym z zastrz. 1-4. 6. Kompozycja farmaceutyczna zawierająca zmodyfikowane przeciwciało anty-EGFR zdefiniowane w dowolnym z zastrz. 1-4, opcjonalnie wraz z farmaceutycznie tolerowanym nośnikiem, rozpuszczalnikiem lub rozcieńczalnikiem. 7. Kompozycja farmaceutyczna według zastrz. 6, zawierająca dodatkowo lek cytotoksyczny w farmakologicznie skutecznej dawce. 8. Sposób wytwarzania zmodyfikowanego przeciwciała skierowanego na receptor EGF (Her 1) i pochodzącego od mysiego przeciwciała mAb 425 i zawierającego, w porównaniu do oryginalnego immunogenicznie niezmodyfikowanego przeciwciała, zredukowaną liczbę sekwencji epitopów limfocytu T, które są ligandami MHC klasy II lub sekwencjami peptydowymi wykazującymi zdolność do stymulowania lub wiązania komórek T poprzez prezentację na klasie II, i będące zasadniczo nieimmunogenne lub mniej immunogenne niż jakiekolwiek oryginalne immunogenicznie niezmodyfikowane przeciwciało skierowane na ten sam receptor podczas narażenia na system immunologiczny danego gatunku, znamienny tym, że obejmuje następujące etapy: (i) określenie sekwencji aminokwasowej ciężkiego i/lub lekkiego łańcucha oryginalnego immunogenicznie niezmodyfikowanego przeciwciała lub jego fragmentu; (ii) identyfikacja jednego lub większej liczby potencjalnych epitopów limfocytu T w obrębie sekwencji aminokwasowej przeciwciała dowolną metodą włączając w to określenie wiązania peptydów do cząsteczki MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych, przy czym rzeczona identyfikacja obejmuje następujące etapy: (a) wybór regionu peptydu mającego znaną sekwencję reszt aminokwasowych;

24

PL 206 843 B1

(b) sekwencyjne pobieranie do analizy nakładających się segmentów reszt aminokwasowych o założonym jednakowym rozmiarze i złożonych z przynajmniej trzech reszt aminokwasowych z wybranego regionu; (c) wyliczenie punktacji wiązania MHC klasy II dla każdego pobranego do analizy segmentu poprzez zsumowanie wyznaczonych wartości dla każdego hydrofobowego bocznego łańcucha reszt aminokwasowych, obecnego w rzeczonym pobranym do analizy segmencie reszt aminokwasowych, przy czym etap ten jest przeprowadzany z zastosowaniem funkcji punktacyjnej Böhma zmodyfikowanej dla uwzględnienia wyrazu energii odpychania 12-6 van der Waalsa ligand-białko i wyrazu energii konformacji ligandu poprzez (1) dostarczenie pierwszej bazy danych modeli cząsteczki MHC klasy II; (2) dostarczenie drugiej bazy danych dopuszczalnych łańcuchów głównych peptydu dla rzeczonych modeli cząsteczki MHC klasy II; (3) wybór modelu z pierwszej rzeczonej bazy danych; (4) wybór dopuszczalnego łańcucha głównego z rzeczonej drugiej bazy danych; (5) określenie reszty aminokwasowej bocznych łańcuchów obecnej w każdym pobranym do analizy segmencie; (6) określenie wartości powinowactwa wiązania dla wszystkich bocznych łańcuchów obecnych w każdym wziętym do analizy łańcuchu; i powtórzenie etapów (1) do (5) dla każdego rzeczonego modelu oraz dla każdego rzeczonego łańcucha głównego; i (d) identyfikacja przynajmniej jednego z rzeczonych segmentów odpowiedniego do modyfikacji, w oparciu o wyliczoną dla tego segmentu punktacje wiązania cząsteczki MHC klasy II, dla zmiany całkowitej punktacji wiązania MHC klasy II dla peptydu bez zasadniczej redukcji terapeutycznego zastosowania tego peptydu; (iii) projektowanie wariantów nowej sekwencji z jednym lub większą liczbą aminokwasów w obrębie określonych potencjalnych epitopów limfocytu T zmodyfikowanych w taki sposób, aby zasadniczo zredukować lub wyeliminować aktywność epitopu limfocytu T jak określono przez wiązanie peptydów do cząsteczek MHC z zastosowaniem technik in vitro lub in silico lub metod biologicznych, lub poprzez wiązanie kompleksów białko-MHC z limfocytami T, przy czym modyfikacja epitopu limfocytu T jest przeprowadzana przez substytucję 1-9 reszt aminokwasowych w dowolnym z oryginalnie obecnych epitopów limfocytu T, (iv) konstruowanie takich wariantów sekwencji technikami rekombinacji DNA i testowanie rzeczonych wariantów dla określenia jednego lub większej liczby wariantów o pożądanych właściwościach; i (v) opcjonalnie powtarzanie etapów (ii), (iii) i (iv). 9. Sposób według zastrz. 8, znamienny tym, że rzeczone oryginalne immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem chimerycznym. 10. Sposób według zastrz. 8, znamienny tym, że rzeczone immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem nie pochodzącym od człowieka, zawierającym reszty powierzchniowe za wyjątkiem tych nie będących w pobliżu regionów CDR, które pochodzą od odpowiednich ludzkich referencyjnych sekwencji szkieletowych. 11. Sposób według zastrz. 8, znamienny tym, że rzeczone oryginalnie immunogenicznie niezmodyfikowane przeciwciało jest przeciwciałem mysim mAb 425. 12. Sposób według dowolnego z zastrz. 8-11, znamienny tym, że rzeczone immunogenicznie niezmodyfikowane przeciwciało skierowane na receptor EGFR zawiera sekwencje VH i VK wybrane z grupy obejmującej: sekwencję VH1: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRNYN EKFKSRVTITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK1: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH2: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYN EKFKSRVTIWDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS

PL 206 843 B1

25

sekwencję VK2: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH3: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRVTIWDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGOGTTLWSS sekwencję VK3: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK sekwencję VH4: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYN EKFKSRATLWDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS sekwencję VK4: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK sekwencję VH5: QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYN EKFKSRATLTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS sekwencję VK5: QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSG SGSGTSYTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK.

26

PL 206 843 B1

Departament Wydawnictw UP RP Cena 4,00 zł

View more...

Comments

Copyright © 2017 UPDOC Inc.